Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella boydii serotype 18 Undecaprenyl-diphosphatase (uppP)

This Recombinant Shigella boydii serotype 18 Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-273.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

B2U1G1

Expression Region

1-273

Origin

Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV VVMFWRRLFGLIGIHFGRPLQHEGESKGRLTLIHILLGMIPAVVLGLLFHDTIKSLFNPI NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGFLTTGDIPMFAVGFITAFVVALI AIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-L Recombinant Chimeric Antibody Antibody
HA601409 100 µL

NF-L Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Aox2 Mouse Gene Knockout Kit (CRISPR)
KN501347 1 Kit

Aox2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lymphoid tissue
CS640562 5x 5 µm

Tissue FFPE Sections, Lymphoid tissue

Sign In for Pricing
View Details
WDFY3 Antibody: Biotin
SPC-666D-BI 100 µg

WDFY3 Antibody: Biotin

Sign In for Pricing
View Details
Cytokeratin 8/18 (B22.1 + B23.1), 0.2mg/mL
BNUB1221-100 1x 100 µL

Cytokeratin 8/18 (B22.1 + B23.1), 0.2mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS634544 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details