H2BC11, Human
The H2BC11 protein functions as a core component of nucleosomes, the fundamental units in chromatin structure that wrap and compact DNA, regulating its accessibility to cellular processes that require DNA as a template. Histones, including H2BC11, play central roles in transcriptional regulation, DNA repair, DNA replication, and chromosome stability. H2BC11 Protein, Human is the recombinant human-derived H2BC11 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
H2BC11 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/h2bc11-protein-human.html
Smiles
PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Molecular Formula
8970 (Gene_ID) P06899 (P2-K126) (Accession)
Molecular Weight
Approximately 13.8 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG, 15nm
Sealing film for storage DMSO-resistant allows visual inspection