Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOSC6 Rabbit Polyclonal Antibody (HRP)

EXOSC6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P11, EAP4, MTR3, Mtr3p, hMtr3p

UniProt

Q5RKV6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EXOSC6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_478126

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SAMHD1 Antibody
A00592 100 µg

Anti-SAMHD1 Antibody

Sign In for Pricing
View Details
AHR antagonist 5
T10272-01 25 mg

AHR antagonist 5

Sign In for Pricing
View Details
AHR antagonist 5
T10272-02 50 mg

AHR antagonist 5

Sign In for Pricing
View Details
AHR antagonist 5
T10272-03 100 mg

AHR antagonist 5

Sign In for Pricing
View Details
Lentiviral human TANC2 sgRNA gene knockout kit - Lentiviral human TANC2 sgRNA gene knockout kit (plasmid)
GTR15363470 1 Vial

Lentiviral human TANC2 sgRNA gene knockout kit - Lentiviral human TANC2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Abiraterone Impurity B
RM-A021802-01 10 mg

Abiraterone Impurity B

Sign In for Pricing
View Details