Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35C1 Rabbit Polyclonal Antibody (FITC)

SLC35C1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CDG2C, FUCT1

UniProt

Q96A29

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC35C1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060859

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bacillus subtilis Uncharacterized membrane protein ywcD (ywcD)
orb2921668-01 20 µg

Recombinant Bacillus subtilis Uncharacterized membrane protein ywcD (ywcD)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized membrane protein ywcD (ywcD)
orb2921668-02 100 µg

Recombinant Bacillus subtilis Uncharacterized membrane protein ywcD (ywcD)

Sign In for Pricing
View Details
CD151 (CD151 Antigen, CD151 Molecule, GP27, Membrane Glycoprotein SFA1, MER2, Platelet Endothelial Tetraspan Antigen 3, PETA 3, PETA-3, RAPH, SFA 1, SFA1, SFA-1, Tetraspanin-24, TSPAN-24) (MaxLight 650)
C2548-82E-ML650 100 µL

CD151 (CD151 Antigen, CD151 Molecule, GP27, Membrane Glycoprotein SFA1, MER2, Platelet Endothelial Tetraspan Antigen 3, PETA 3, PETA-3, RAPH, SFA 1, SFA1, SFA-1, Tetraspanin-24, TSPAN-24) (MaxLight 650)

Sign In for Pricing
View Details
Dynamin 1 (DNM1) Magnetic Luminex Assay Kit
LKU605565 96 Tests

Dynamin 1 (DNM1) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Rac/Cdc42 Activator II
CN02-B 20x 10 Units

Rac/Cdc42 Activator II

Sign In for Pricing
View Details
Endogl1 Peptide - N-terminal region
MBS3233210-01 0.1 mg

Endogl1 Peptide - N-terminal region

Sign In for Pricing
View Details