Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ywcD (ywcD)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ywcD (ywcD) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ywcD

UniProt

P39602

Expression Region

1-127

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYIIMGVFTTIVNIASFYILVEIMNVDYKAATVAAWILSVLFAYITNKLYVFQQKTHDLQ SLLKELTAFFSVRVLSLGIDLGMMIILVGQFNTNETLAKILDNAVIVVVNYVASKWLVFK KTKEEGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AK3 Mouse Monoclonal Antibody [Clone ID: OTI5A1]
CF501819 100 µg

AK3 Mouse Monoclonal Antibody [Clone ID: OTI5A1]

Sign In for Pricing
View Details
D11WSU47E Adenovirus (Mouse)
17567054 1.0 mL

D11WSU47E Adenovirus (Mouse)

Sign In for Pricing
View Details
CAF-1 p150 (C-5) : m-IgG1 BP-HRP Bundle
sc-541743 1 Kit

CAF-1 p150 (C-5) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
PBST with Kathon 20X, with 2% Tween 20, pH 7.4
40120182-1 1 L

PBST with Kathon 20X, with 2% Tween 20, pH 7.4

Sign In for Pricing
View Details
SLC22A7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV715103 1.0 µg DNA

SLC22A7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rabbit Monoclonal Glycophorin A Antibody (GYPA/3219R) [DyLight 594]
NBP3-08261DL594 100 µL

Rabbit Monoclonal Glycophorin A Antibody (GYPA/3219R) [DyLight 594]

Sign In for Pricing
View Details