Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ywcD (ywcD)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ywcD (ywcD) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ywcD

UniProt

P39602

Expression Region

1-127

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYIIMGVFTTIVNIASFYILVEIMNVDYKAATVAAWILSVLFAYITNKLYVFQQKTHDLQ SLLKELTAFFSVRVLSLGIDLGMMIILVGQFNTNETLAKILDNAVIVVVNYVASKWLVFK KTKEEGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Gadd45g/Growth arrest and DNA damage-inducible protein GADD45 gamma ELISA Kit
E0381Ra 96 Tests

Rat Gadd45g/Growth arrest and DNA damage-inducible protein GADD45 gamma ELISA Kit

Sign In for Pricing
View Details
Olfr1305 Double Nickase Plasmid (m)
sc-434546-NIC 20 µg

Olfr1305 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Pig Tissue factor (TF) ELISA Kit
AE17065PI-01 48 Tests

Pig Tissue factor (TF) ELISA Kit

Sign In for Pricing
View Details
Pig Tissue factor (TF) ELISA Kit
AE17065PI-02 96 Tests

Pig Tissue factor (TF) ELISA Kit

Sign In for Pricing
View Details
K27-linkage specific ubiquitin Recombinant Antibody, Cy5 Conjugated
bsm-63007R-Cy5-01 20 µL

K27-linkage specific ubiquitin Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
K27-linkage specific ubiquitin Recombinant Antibody, Cy5 Conjugated
bsm-63007R-Cy5-02 100 µL

K27-linkage specific ubiquitin Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details