Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSH1 Rabbit Polyclonal Antibody (FITC)

CSH1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PL, CSA, CS-1, CSMT, GHB3, hCS-1, hCS-A

UniProt

P01243

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CSH1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001308

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Integrin beta 1 Recombinant Protein
PROTP05556-20ug 20 µg

Human Integrin beta 1 Recombinant Protein

Sign In for Pricing
View Details
Human Collagen Type III Alpha 1 (COL3α1) ELISA Kit
orb1807605-01 48 Tests

Human Collagen Type III Alpha 1 (COL3α1) ELISA Kit

Sign In for Pricing
View Details
Human Collagen Type III Alpha 1 (COL3α1) ELISA Kit
orb1807605-02 96 Tests

Human Collagen Type III Alpha 1 (COL3α1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human LBH domain-containing protein 2 (LBHD2)
orb3010311-01 20 µg

Recombinant Human LBH domain-containing protein 2 (LBHD2)

Sign In for Pricing
View Details
Recombinant Human LBH domain-containing protein 2 (LBHD2)
orb3010311-02 100 µg

Recombinant Human LBH domain-containing protein 2 (LBHD2)

Sign In for Pricing
View Details
Recombinant Human LBH domain-containing protein 2 (LBHD2)
orb3010311-03 1 mg

Recombinant Human LBH domain-containing protein 2 (LBHD2)

Sign In for Pricing
View Details