Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LBH domain-containing protein 2 (LBHD2)

This Recombinant Human LBH domain-containing protein 2 (LBHD2) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LBH domain-containing protein 2 LBHD2

UniProt

A0A0U1RRK4

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSTPRPAPPQPGAAEGAGGPEGKAVAGAWEKGPRLGQRLPSIVVEPSEADPVESGELRWPLESAQRGPSQSRAAAAPSPSLPGEPGKAADNAGSECACSEDPAAPARG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1365), 1mg/mL
BNUM1365-50 1x 50 µL

Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1365), 1mg/mL

Sign In for Pricing
View Details
Biotin-20-UTP, 1 mM in pH 7.5 Tris-HCl Buffer
#40034 1x 25 µL

Biotin-20-UTP, 1 mM in pH 7.5 Tris-HCl Buffer

Sign In for Pricing
View Details
Human Low Density Lipoprotein Receptor Related Protein 5 (LRP5) ELISA Kit
RDR-LRP5-Hu-01 96 Tests

Human Low Density Lipoprotein Receptor Related Protein 5 (LRP5) ELISA Kit

Sign In for Pricing
View Details
Human Low Density Lipoprotein Receptor Related Protein 5 (LRP5) ELISA Kit
RDR-LRP5-Hu-02 48 Tests

Human Low Density Lipoprotein Receptor Related Protein 5 (LRP5) ELISA Kit

Sign In for Pricing
View Details
Enkephalin (PENK) (NM_006211) Human Recombinant Protein
TP307563L 1 mg

Enkephalin (PENK) (NM_006211) Human Recombinant Protein

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (N/A), CF405S conjugate, 0.1mg/mL
BNC041794-100 1x 100 µL

CD45RB (B-Cell Marker) (N/A), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details