Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LBH domain-containing protein 2 (LBHD2)

This Recombinant Human LBH domain-containing protein 2 (LBHD2) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LBH domain-containing protein 2 LBHD2

UniProt

A0A0U1RRK4

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSTPRPAPPQPGAAEGAGGPEGKAVAGAWEKGPRLGQRLPSIVVEPSEADPVESGELRWPLESAQRGPSQSRAAAAPSPSLPGEPGKAADNAGSECACSEDPAAPARG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proteasome subunit beta type 2 (PSMB2) (NM_002794) Human Over-expression Lysate
LC419104 20 µg

Proteasome subunit beta type 2 (PSMB2) (NM_002794) Human Over-expression Lysate

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), CF405S conjugate, 0.1mg/mL
BNC040743-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UBE2D2 Mouse Monoclonal Antibody [Clone ID: OTI1D2]
CF806505 100 µg

UBE2D2 Mouse Monoclonal Antibody [Clone ID: OTI1D2]

Sign In for Pricing
View Details
Purine
TRC-P840288-500MG 500 mg

Purine

Sign In for Pricing
View Details
Human TNF-α (Tumor Necrosis Factor Alpha) CLIA Kit
E-CL-H0108-01 24 Tests

Human TNF-α (Tumor Necrosis Factor Alpha) CLIA Kit

Sign In for Pricing
View Details
Human TNF-α (Tumor Necrosis Factor Alpha) CLIA Kit
E-CL-H0108-02 48 Tests

Human TNF-α (Tumor Necrosis Factor Alpha) CLIA Kit

Sign In for Pricing
View Details