Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2F8 Rabbit Polyclonal Antibody (HRP)

E2F8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

E2F-8

UniProt

A0AVK6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human E2F8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QLVAESFFRTPGGPTKPTSSSCMDFEGANKTSLGTLFVPQRKLEVSTEDV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

94kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_078956

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human chromosome 14 open reading frame 166 polyclonal Antibody
MBS710448-01 0.1 mL

Rabbit anti-human chromosome 14 open reading frame 166 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human chromosome 14 open reading frame 166 polyclonal Antibody
MBS710448-02 5x 0.1 mL

Rabbit anti-human chromosome 14 open reading frame 166 polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Myosin light chain 5 (MYL5), Biotinylated
orb3008475-01 20 µg

Recombinant Human Myosin light chain 5 (MYL5), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Myosin light chain 5 (MYL5), Biotinylated
orb3008475-02 100 µg

Recombinant Human Myosin light chain 5 (MYL5), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Myosin light chain 5 (MYL5), Biotinylated
orb3008475-03 1 mg

Recombinant Human Myosin light chain 5 (MYL5), Biotinylated

Sign In for Pricing
View Details
SOX1 Peptide - C-terminal region
orb2008907 100 µg

SOX1 Peptide - C-terminal region

Sign In for Pricing
View Details