Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myosin light chain 5 (MYL5), Biotinylated

This Recombinant Human Myosin light chain 5 (MYL5), Biotinylated spans the amino acid sequence from region 1-173. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myosin light chain 5; Myosin regulatory light chain 5; Superfast myosin regulatory light chain 2; MYLC2; MyLC-2; MYL5

UniProt

Q02045

Expression Region

1-173

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-500 1x 500 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-500 1x 500 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF640R conjugate, 0.1mg/mL
BNC400160-100 1x 100 µL

CD20 (B9E9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL
BNC940226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
BNC470676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details