Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX1 Peptide - C-terminal region

SOX1 Peptide - C-terminal region

Product Specifications

UniProt

O00570

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SOX1 Rabbit Polyclonal Antibody (orb329775) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005977

Preservative

Lyophilized powder

AA Sequence

ALGSLVKSEPSGSPPAPAHSRAPCPGDLREMISMYLPAGEGGDPAAAAAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SFTPA1 activation kit by CRISPRa
GA118848 1 Kit

Human SFTPA1 activation kit by CRISPRa

Sign In for Pricing
View Details
N,5-Bis(4-chlorophenyl)-3,5-dihydro-3-imino-2-phenazinamine Hydrochloride
TRC-B419200-25MG 25 mg

N,5-Bis(4-chlorophenyl)-3,5-dihydro-3-imino-2-phenazinamine Hydrochloride

Sign In for Pricing
View Details
Syntrophin alpha 1 Rabbit Polyclonal Antibody
ER1901-40 100 µL

Syntrophin alpha 1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FLT4 (1279-1283) Rabbit Polyclonal Antibody
AP26050PU-S 50 µL

FLT4 (1279-1283) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MRPL53 (NM_053050) Human Recombinant Protein
TP304255L 1 mg

MRPL53 (NM_053050) Human Recombinant Protein

Sign In for Pricing
View Details
Rnf111 Mouse Gene Knockout Kit (CRISPR)
KN514888 1 Kit

Rnf111 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details