Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wasf2 Rabbit Polyclonal Antibody (HRP)

Wasf2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

WAV, WAVE2, AW742646, D4Ertd13, D4Ertd13e

UniProt

Q8BH43

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALKFYTNPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRK

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_700472

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose Neuroligin 1 (NLGN1) ELISA Kit
MBS9353056 Inquire

Goose Neuroligin 1 (NLGN1) ELISA Kit

Sign In for Pricing
View Details
Hsa-miR-3158-3p miRNA Agomir
CMJ0947-01 5 nmol

Hsa-miR-3158-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-3158-3p miRNA Agomir
CMJ0947-02 10 nmol

Hsa-miR-3158-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-3158-3p miRNA Agomir
CMJ0947-03 20 nmol

Hsa-miR-3158-3p miRNA Agomir

Sign In for Pricing
View Details
Recombinant Danio rerio Cytochrome c oxidase subunit 3 (mt-co3)
orb2907949-01 20 µg

Recombinant Danio rerio Cytochrome c oxidase subunit 3 (mt-co3)

Sign In for Pricing
View Details
Recombinant Danio rerio Cytochrome c oxidase subunit 3 (mt-co3)
orb2907949-02 100 µg

Recombinant Danio rerio Cytochrome c oxidase subunit 3 (mt-co3)

Sign In for Pricing
View Details