Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Cytochrome c oxidase subunit 3 (mt-co3)

This Recombinant Danio rerio Cytochrome c oxidase subunit 3 (mt-co3) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

Q9MIY4

Expression Region

1-261

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAHQAHAYHMVDPSPWPLTGAVAALLMSSGLAIWFHLHSMTLIVLGMILLILTMIQWWRD IIREGTFQGHHTPPVQKGLRYGMILFITSEVFFFLGFFWAFYHSSLAPTPELGGCWPPTG LTTLDPFEVPLLNTAVLLASGVTVTWAHHSLMEGERKQAIQSLALTILLGLYFTALQAME YYEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQVLFHFTSDHHFGFEAAAW YWHFVDVVWLFLYVSIYWWGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tuxobertinib (BDTX-189)
C14469-10mM/1mL 10 mM/1mL

Tuxobertinib (BDTX-189)

Sign In for Pricing
View Details
Sodium Cacodylate Buffer 0.1M, pH 6.8
NBB-170-01 100 mL

Sodium Cacodylate Buffer 0.1M, pH 6.8

Sign In for Pricing
View Details
Sodium Cacodylate Buffer 0.1M, pH 6.8
NBB-170-02 250 mL

Sodium Cacodylate Buffer 0.1M, pH 6.8

Sign In for Pricing
View Details
ABHD7 (EPHX4) (NM_173567) Human Over-expression Lysate
LS253152 100 µg

ABHD7 (EPHX4) (NM_173567) Human Over-expression Lysate

Sign In for Pricing
View Details
C6orf120 Rabbit Polyclonal Antibody (RBITC)
orb1015506 100 µL

C6orf120 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
EIF4ENIF1 Rabbit Polyclonal Antibody (HRP)
orb2101790 100 µL

EIF4ENIF1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details