Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Cytochrome c oxidase subunit 3 (mt-co3)

This Recombinant Danio rerio Cytochrome c oxidase subunit 3 (mt-co3) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

Q9MIY4

Expression Region

1-261

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAHQAHAYHMVDPSPWPLTGAVAALLMSSGLAIWFHLHSMTLIVLGMILLILTMIQWWRD IIREGTFQGHHTPPVQKGLRYGMILFITSEVFFFLGFFWAFYHSSLAPTPELGGCWPPTG LTTLDPFEVPLLNTAVLLASGVTVTWAHHSLMEGERKQAIQSLALTILLGLYFTALQAME YYEAPFTIADGVYGSTFFVATGFHGLHVIIGSTFLAVCLLRQVLFHFTSDHHFGFEAAAW YWHFVDVVWLFLYVSIYWWGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNK10 Protein Vector (Rat) (pPM-C-HA)
25392026 500 ng

KCNK10 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
MK13 Polyclonal Antibody
RA33323-01 50 µL

MK13 Polyclonal Antibody

Sign In for Pricing
View Details
MK13 Polyclonal Antibody
RA33323-02 100 µL

MK13 Polyclonal Antibody

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Enhancer Of Zeste Homolog 2 (EZH2)
MBS2081982-01 0.1 mL

HRP-Linked Polyclonal Antibody to Enhancer Of Zeste Homolog 2 (EZH2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Enhancer Of Zeste Homolog 2 (EZH2)
MBS2081982-02 0.2 mL

HRP-Linked Polyclonal Antibody to Enhancer Of Zeste Homolog 2 (EZH2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Enhancer Of Zeste Homolog 2 (EZH2)
MBS2081982-03 0.5 mL

HRP-Linked Polyclonal Antibody to Enhancer Of Zeste Homolog 2 (EZH2)

Sign In for Pricing
View Details