Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MINDY4B Rabbit Polyclonal Antibody (HRP)

MINDY4B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C3orf76, FAM188B2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LOC646951

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNING

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

XP_935009

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf25 Polyclonal Antibody, PE Conjugated
bs-15324R-PE 100 µL

C9orf25 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)
orb2658712-01 20 µg

Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)

Sign In for Pricing
View Details
Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)
orb2658712-02 100 µg

Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)

Sign In for Pricing
View Details
Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)
orb2658712-03 1 mg

Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)

Sign In for Pricing
View Details
Anti-MBD2 Antibody Picoband® (PE Conjugate)
RP1049-PE 100 µg/Vial

Anti-MBD2 Antibody Picoband® (PE Conjugate)

Sign In for Pricing
View Details
THAP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2367406 1.0 µg DNA

THAP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details