Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)

This Recombinant Bovine Fibroblast growth factor 2 (FGF2) spans the amino acid sequence from region 10-155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor (bFGF) ; Heparin-binding growth factor 2 (HBGF-2) ; Kidney-derived growth factor; FGF2

UniProt

P03969

Expression Region

10-155aa

Tag

Tag-Free

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of NIH-3T3 cells is 0.9252-2.630 ng/mL.

Form

Lyophilized powder

Molecular Weight

16.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4E2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
19161062 1.0 µg DNA

EIF4E2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse Monoclonal RHAMM/CD168 Antibody (2F2C9)
NBP2-52437-0.025mg 0.025 mg

Mouse Monoclonal RHAMM/CD168 Antibody (2F2C9)

Sign In for Pricing
View Details
Ferredoxin Reductase (FDXR) Antibody
abx112516 100 µL

Ferredoxin Reductase (FDXR) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CD99 Antibody (1021527) [Janelia Fluor 585]
FAB3968JF585 0.1 mL

Mouse Monoclonal CD99 Antibody (1021527) [Janelia Fluor 585]

Sign In for Pricing
View Details
Rabbit Monoclonal Complement Component C2 Antibody (002) [Biotin]
NBP2-89300B 0.1 mL

Rabbit Monoclonal Complement Component C2 Antibody (002) [Biotin]

Sign In for Pricing
View Details
Anti-IKZF4 Antibody, Rabbit Polyclonal
MBS8110078-01 0.1 mL

Anti-IKZF4 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details