Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)

This Recombinant Bovine Fibroblast growth factor 2 (FGF2) spans the amino acid sequence from region 10-155aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor (bFGF) ; Heparin-binding growth factor 2 (HBGF-2) ; Kidney-derived growth factor; FGF2

UniProt

P03969

Expression Region

10-155aa

Tag

Tag-Free

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of NIH-3T3 cells is 0.9252-2.630 ng/mL.

Form

Lyophilized powder

Molecular Weight

16.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Desmethyl Edoxaban
CS-O-14827 1 Each

N-Desmethyl Edoxaban

Sign In for Pricing
View Details
HPGD (15-hydroxyprostaglandin Dehydrogenase [NAD+], 15-PGDH, Prostaglandin Dehydrogenase 1, PGDH1) (Biotin)
128058-Biotin 100 µL

HPGD (15-hydroxyprostaglandin Dehydrogenase [NAD+], 15-PGDH, Prostaglandin Dehydrogenase 1, PGDH1) (Biotin)

Sign In for Pricing
View Details
Rabbit anti-Synechococcus elongatus (strain PCC 7942)(Anacystis nidulans R2) rpsJ Polyclonal Antibody
MBS7193525 Inquire

Rabbit anti-Synechococcus elongatus (strain PCC 7942)(Anacystis nidulans R2) rpsJ Polyclonal Antibody

Sign In for Pricing
View Details
PfkA Antibody
orb824035 2 mg

PfkA Antibody

Sign In for Pricing
View Details
Narcissus pseudonarcissus (NPA)
N0019-45 1 mg

Narcissus pseudonarcissus (NPA)

Sign In for Pricing
View Details
PLA2G4E (NM_001206670) Human Untagged Clone
SC329827 10 µg

PLA2G4E (NM_001206670) Human Untagged Clone

Sign In for Pricing
View Details