Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM3C, Human (HEK293, His)

The FAM3C protein emerged as a potential contributor to different cellular processes with a role in retinal lamination formation, emphasizing its involvement in retinal development. In addition, FAM3C is also involved in promoting epithelial-mesenchymal transition (EMT), indicating its potential impact on cell differentiation and tissue remodeling. FAM3C Protein, Human (HEK293, His) is the recombinant human-derived FAM3C protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FAM3C Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fam3c-protein-human-hek-293-his.html

Purity

98.00

Smiles

QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD

Molecular Formula

10447 (Gene_ID) Q92520 (Q25-D227) (Accession)

Molecular Weight

Approximately 20-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cytokeratin 10 Antibody (VIK-10) [Alexa Fluor 647]
NB500-354AF647 0.1 mL

Mouse Monoclonal Cytokeratin 10 Antibody (VIK-10) [Alexa Fluor 647]

Sign In for Pricing
View Details
Cytokeratin 15 Antibody
orb2642513 7 mL

Cytokeratin 15 Antibody

Sign In for Pricing
View Details
DRD4 Adenovirus (Mouse)
18597054 1.0 mL

DRD4 Adenovirus (Mouse)

Sign In for Pricing
View Details
Recombinant Human Olfactory receptor 2M7 (OR2M7)
orb2906545-01 20 µg

Recombinant Human Olfactory receptor 2M7 (OR2M7)

Sign In for Pricing
View Details
Recombinant Human Olfactory receptor 2M7 (OR2M7)
orb2906545-02 100 µg

Recombinant Human Olfactory receptor 2M7 (OR2M7)

Sign In for Pricing
View Details
P38 MAPK
E8ET1702-65 100 µL

P38 MAPK

Sign In for Pricing
View Details