Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2M7 (OR2M7)

This Recombinant Human Olfactory receptor 2M7 (OR2M7) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2M7, Olfactory receptor OR1-58

UniProt

Q8NG81

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAWENQTFNSDFLLLGIFNHSPTHTFLFFLVLAIFSVAFMGNSIMVLLIYLDTQLHTPMY FLLSQLSLMDLMLICTTVPKMAFNYLSGSKSISMAGCATQIFFYISLLGSECFLLAVMSY DRYTAICHPLRYTNLMRPKICGLMTAFSWILGSTDGIIDAVATFSFSYCGSREIAHFCCD FPSLLILSCNDTSIFEEVIFICCIVMLVFPVAIIITSYARVILAVIHMGSGEGRRKAFTT CSSHLMVVGMYYGAGLFMCIQPTSHHSPMQDKMVSVFYTIVTPMLNPLIYSLRNKEVTRA LMKILGKGKSGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Obeticholic acid 3-O-β-D-glucuronide
GC9805-1mg 1 mg

Obeticholic acid 3-O-β-D-glucuronide

Sign In for Pricing
View Details
Duck Transcription Factor-Like 5 Protein (TCFL5) ELISA Kit
MBS9946345 Inquire

Duck Transcription Factor-Like 5 Protein (TCFL5) ELISA Kit

Sign In for Pricing
View Details
MCF7 nuclear extract
sc-2149 4 x 250 µg/0.05 mL

MCF7 nuclear extract

Sign In for Pricing
View Details
5'-O-DMTr-2'-deoxy-5-iodouridine-3'-CED Phosphoramidite
TNU0676-01 10 mg

5'-O-DMTr-2'-deoxy-5-iodouridine-3'-CED Phosphoramidite

Sign In for Pricing
View Details
5'-O-DMTr-2'-deoxy-5-iodouridine-3'-CED Phosphoramidite
TNU0676-02 100 mg

5'-O-DMTr-2'-deoxy-5-iodouridine-3'-CED Phosphoramidite

Sign In for Pricing
View Details
5'-O-DMTr-2'-deoxy-5-iodouridine-3'-CED Phosphoramidite
TNU0676-03 25 mg

5'-O-DMTr-2'-deoxy-5-iodouridine-3'-CED Phosphoramidite

Sign In for Pricing
View Details