Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2M7 (OR2M7)

This Recombinant Human Olfactory receptor 2M7 (OR2M7) spans the amino acid sequence from region 1-312.

Product Specifications

Product Name Alternative

Olfactory receptor 2M7, Olfactory receptor OR1-58

UniProt

Q8NG81

Expression Region

1-312

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAWENQTFNSDFLLLGIFNHSPTHTFLFFLVLAIFSVAFMGNSIMVLLIYLDTQLHTPMY FLLSQLSLMDLMLICTTVPKMAFNYLSGSKSISMAGCATQIFFYISLLGSECFLLAVMSY DRYTAICHPLRYTNLMRPKICGLMTAFSWILGSTDGIIDAVATFSFSYCGSREIAHFCCD FPSLLILSCNDTSIFEEVIFICCIVMLVFPVAIIITSYARVILAVIHMGSGEGRRKAFTT CSSHLMVVGMYYGAGLFMCIQPTSHHSPMQDKMVSVFYTIVTPMLNPLIYSLRNKEVTRA LMKILGKGKSGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cstf2 (NM_001131014) Rat Tagged ORF Clone Lentiviral Particle
RR202236L3V 200 µL

Cstf2 (NM_001131014) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
(3-Ethoxy-6-methylpyridin-2-yl) methanol
DZB18812-01 50 mg

(3-Ethoxy-6-methylpyridin-2-yl) methanol

Sign In for Pricing
View Details
(3-Ethoxy-6-methylpyridin-2-yl) methanol
DZB18812-02 0.5 g

(3-Ethoxy-6-methylpyridin-2-yl) methanol

Sign In for Pricing
View Details
ERG/KCNH2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-23703R-BF594-TR 20 µL

ERG/KCNH2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
pCR4-TOPO-MXD1-2 Plasmid
PVT33621 2 µg

pCR4-TOPO-MXD1-2 Plasmid

Sign In for Pricing
View Details
NGFR Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-43637R-PerCP-Cy5.5 100 µL

NGFR Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details