TdTomato Antibody

Antigen: Purified recombinant peptide produced in E. coli. Antigen Sequence: MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

MEQKLISEEDLGTISTMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSNGGMDEVYK

Polyclonal antibody supplied as a 200 or 500 μl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.

Yang, Yang et al. Derivation of Pluripotent Stem Cells with In Vivo Embryonic and Extraembryonic Potency Cell, 169, 243-257.e25 (2017), Mao, Xiying et al. Single-Cell RNA Sequencing of hESC-Derived 3D Retinal Organoids Reveals Novel Genes Regulating RPC Commitment in Early Human Retinogenesis Stem Cell Reports, (2019), Li Li # 1 2 3, Yu He # 1 2 3, Kai Liu 4, Lin Liu 1 2 3, Shan Shan 1 2 3, Helin Liu 1 2 3, Jiangbo Ren 1 2 3, Shujie Sun 1 2 3, Min Wang 1 2 3, Jidong Jia 5 6 7, Ping Wang GITRL impairs hepatocyte repopulation by liver progenitor cells to aggravate inflammation and fibrosis by GITR+CD8+ T lymphocytes in CDE Mice Cell Death Dis, 15, 114 (2024), Jia Sun #1, Xinyuan Wang #12, Rui Sun 1, Xiaoao Xiao 1, Yu Wang 1, Yu Peng 1, Yuanqing Gao 3 Microglia shape AgRP neuron postnatal development via regulating perineuronal net plasticity Mol Psychiatry, (2023), Jian Ge 1, Hongxia Shao 1 2, Hongxu Ding 3, Yuefeng Huang 4, Xuebing Wu 5, Jie Sun 6, Jianwen Que Single Cell Analysis of Lung Lymphatic Endothelial Cells and Lymphatic Responses during Influenza Infection J Respir Biol Transl Med, 1, 10003 (2024), Capdevila Castillo, Claudia Identification of a Homeostatic Stem Cell Population in the Intestinal Upper Crypt academiccommons.columbia.edu, , Jiangying Liu 1, Dan Luo 1, Haidi Huang 1, Rongzi Mu 1, Jianghong Yuan 1, Ming Jiang 2, Chuwen Lin 3, Honggang Xiang 4, Xinhua Lin 5, Haihan Song 6 7, Yongchun Zhang Hippo signaling cooperates with p53 to regulate lung airway mucous cell metaplasia Dis Model Mech, (2024), Jian He 1, Yangyang Cao 1, Qian Zhu 2, Xinge Wang 1, Guo Cheng 3, Qiang Wang 4, Rukun He 1, Haoran Lu 5, Yuancheng Weng 1, Genxiang Mao 6, Yizhong Bao 6, Jing Wang 7, Xiaoli Liu 8, Fei Han 9, Peng Shi 10, Xiao Z Shen Renal macrophages monitor and remove particles from urine to prevent tubule obstruction Immunity, (2024), Xiaogang Zhang 1, Jingping Liu 2, Xinyao Li 3, Guilang Zheng 4, Tianci Wang 3, Hengbiao Sun 2, Zhengcong Huang 3, Junyu He 3, Ju Qiu 5, Zhibin Zhao 6, Yuxiong Guo 4, Yumei He Blocking the HIF-1α/glycolysis axis inhibits allergic airway inflammation by reducing ILC2 metabolism and function Allergy, (2024), Xiangyi Ke 1, Benjamin van Soldt 2, Lukas Vlahos 3, Yizhuo Zhou 4, Jun Qian 5, Joel George 6, Claudia Capdevila 7, Ian Glass 8, Kelley Yan 7, Andrea Califano 9, Wellington V Cardoso Morphogenesis and regeneration share a conserved core transition cell state program that controls lung epithelial cell fate Dev Cell ., (2024), Siwen Chen # 1 2, Yingxin Lin # 3 4 5, Hao Yang # 6, Zihao Li 1 2, Sifang Li 1 2, Dongying Chen 7, Wenjun Hao 1 2, Shuai Zhang 1 2, Hua Chao 1 2, Jingyu Zhang 1 2, Jianru Wang 1 2, Zemin Li 1 2, Xiang Li 1 2, Zhongping Zhan 7, Hui Liu A CD26+ tendon stem progenitor cell population contributes to tendon repair and heterotopic ossification Nat Commun, (2025), Yinshan Fang 1, Sanny S W Chung 1, Le Xu 2, Chenyi Xue 3, Xue Liu 4, Dianhua Jiang 4, Rongbo Li 2, Yohei Korogi 2, Ke Yuan 5, Anjali Saqi 6, Hanina Hibshoosh 6, Yuefeng Huang 7, Chyuan-Sheng Lin 8, Tatsuya Tsukui 9, Dean Sheppard 9, Xin Sun 10, Jianwen Que RUNX2 promotes fibrosis via an alveolar-to-pathological fibroblast transition Nature, (2025), Saida Oubraim 1, Kathryn Hausknecht 1, Veronika Micov 1, Roh-Yu Shen 1 2, Samir Haj-Dahmane Chemogenetic inhibition of prefrontal cortex inputs to dorsal raphe reduces anxiety behaviors in male rat model of fetal alcohol spectrum disorder Sci Rep, (2025), Pomaville, Matthew B. et al. Follicle-innervating A[delta]-low threshold mechanoreceptive neurons form receptive fields through homotypic competition Neural Dev, 18, 2 (2023), Fang, Yinshan et al. Epithelial Wntless regulates postnatal alveologenesis Development, 149, dev199505 (2022), Li, Hui et al. Identification of novel B-1 transitional progenitors by B-1 lymphocyte fate-mapping transgenic mouse model Bhlhe41 dTomato-Cre Front Immunol, 13, 946202 (2022), Contribution of Trp63CreERT2-labeled cells to alveolar regeneration is independent of tuft cells Elife, 11, e78217 (2022), Miller, Daniel S. et al. Neuronal Dystroglycan regulates postnatal development of CCK/cannabinoid receptor-1 interneurons Neural Dev, 16, 4 (2021), SOX9 Modulates the Transformation of Gastric Stem Cells Through Biased Symmetric Cell Division Gastroenterology, S0016-5085 (23) 00109-9 (2023), Therapeutic resistance and susceptibility is shaped by cooperative multi-compartment tumor adaptation Cell Death Differ, 26, 2416-2429 (2019), Yartseva, Valeria et al. Heterogeneity of Satellite Cells Implicates DELTA1/NOTCH2 Signaling in Self-Renewal Cell Rep, 30, 1491-1503.e6 (2020), Yinshan Fang et al. Lyz1-Expressing Alveolar Type II Cells Contribute to Lung Regeneration Journal of Respiratory Biology and Translational Medicine, (2025), Interleukin-9 protects from early podocyte injury and progressive glomerulosclerosis in Adriamycin-induced nephropathy Kidney Int, 98, 615-629 (2020), LECT2, a Ligand for Tie1, Plays a Crucial Role in Liver Fibrogenesis Cell, 178, 1478-1492.e20 (2019), Jiang, Ming et al. VEGF receptor 2 (KDR) protects airways from mucus metaplasia through a Sox9-dependent pathway Dev Cell, 56, 1646-1660.e5 (2021), Hu, Yanyan et al. Induction of mouse totipotent stem cells by a defined chemical cocktail Nature, (2022), Lianjie Miao et al. Distinct populations of vascular smooth muscle and sinoatrial progenitors are localized adjacent to pro-epicardium Cell Rep, (2025), Jiayu Zhou et al. Fzd2 orchestrates canonical and non-canonical Wnt signaling to regulate lung development and fibrosis Cell Commun Signal, (2025), Zhiming Liu et al. Obesity impairs gut repair via AFABP-mediated iron overload in intestinal stem cells Nat Metab, (2026), Zhang, Lianghui et al. Single-cell transcriptomic profiling of lung endothelial cells identifies dynamic inflammatory and regenerative subpopulations JCI Insight, 7, e158079 (2022), He, Jianbo et al. DNA methylation maintenance at the p53 locus initiates biliary-mediated liver regeneration NPJ Regen Med, 7, 21 (2022), Zhang, Junren et al. Tel2 regulates redifferentiation of bipotential progenitor cells via Hhex during zebrafish liver regeneration Cell Rep, 39, 110596 (2022), Gribben, Christopher et al. Ductal Ngn3-expressing progenitors contribute to adult β cell neogenesis in the pancreas Cell Stem Cell, (2021), Jianming Yang et al. A 4-guanidinobutanoic acid-SLC36A1 axis drives a microbiota‒host feedback loop to regulate intestinal homeostasis Gut Microbes, (2026), Yan Cui et al. Retrorsine impairs liver regeneration by inducing progenitor cell-senescence via ROS after partial hepatectomy Ann Med, (2026), Gu, Bin et al. Live imaging YAP signalling in mouse embryo development Open Biol, 12, 210335 (2022)

28388409, 31543471, 38321001, 38001338, 38529320, 39428818, 38159573, 39462230, 39667932, 39820504, 39910313, 40275074, 37106422, 34931663, 36189231, 36129169, 34362433, 36740200, 30824837, 32023464, 32446933, 31474362, 34010630, 35728625, 41259201, 41257888, 41507665, 35511435, 35351894, 35385752, 34478642, 41782409, 41777124, 35042406

For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours

In 293HEK cells transfected with cds plasmid detects a band of 55 kDa by Western blot. It also detects tdTomato in brain sections by IHC. This antibody is specific for tdTomato and mCherry proteins. It does not cross-react to GFP (green fluorescent protein)