Cathepsin E, Mouse (HEK293, His)
Cathepsin E Protein, Mouse (HEK293, His) is an approximately 42.0 kDa mouse cathepsin E with a His tag. Cathepsin E is an aspartic protease and a member of the peptidase A1 family of proteases.[1].
Product Specifications
Product Name Alternative
Cathepsin E Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cathepsin-e-protein-mouse-hek293-his.html
Purity
98.0
Smiles
SCNVYSSVNEPLINYLDMEYFGTISIGTPPQNFTVIFDTGSSNLWVPSVYCTSPACKAHPVFHPSQSDTYTEVGNHFSIQYGTGSLTGIIGADQVSVEGLTVDGQQFGESVKEPGQTFVNAEFDGILGLGYPSLAAGGVTPVFDNMMAQNLVALPMFSVYLSSDPQGGSGSELTFGGYDPSHFSGSLNWIPVTKQAYWQIALDGIQVGDTVMFCSEGCQAIVDTGTSLITGPPDKIKQLQEAIGATPIDGEYAVDCATLDTMPNVTFLINEVSYTLNPTDYILPDLVEGMQFCGSGFQGLDIPPPAGPLWILGDVFIRQFYSVFDRGNNQVGLAPAVPHHHHHH
Molecular Formula
13034 (Gene_ID) P70269 (S60-P397) (Accession)
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]T Tsukuba, et al. New functional aspects of cathepsin D and cathepsin E. Mol Cells|[2]T Azuma, et al. Human gastric cathepsin E. Predicted sequence, localization to chromosome 1, and sequence homology with other aspartic proteinases. J Biol Chem|[3]P J Tatnell, et al. Cloning, expression and characterisation of murine procathepsin E. FEBS Lett. 1997 May 12;408 (1) :62-6.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2916675-01 20 µg
Recombinant Mouse Transmembrane protein 192 (Tmem192)
Sign In for Pricing
View Details orb2916675-02 100 µg
Recombinant Mouse Transmembrane protein 192 (Tmem192)
Sign In for Pricing
View Details 
orb2934600-01 20 µg
Recombinant Nephroselmis olivacea NAD (P) H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)
Sign In for Pricing
View Details orb2934600-02 100 µg
Recombinant Nephroselmis olivacea NAD (P) H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)
Sign In for Pricing
View Details