Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 192 (Tmem192)

This Recombinant Mouse Transmembrane protein 192 (Tmem192) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Transmembrane protein 192

UniProt

Q9CXT7

Expression Region

1-266

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAAGRLEDSSLDILQSMDDDPLLDTQPLPHHSLQAQFRPRFHPLPTVIIANLLLLIHVV FVVLAFLTGVPCLYPNPTEDKCPENYTSPLKVQTAIILGKLILWILHLLFERYVQYHHRK VRSRGYSQIYRSTRHLKTLALTIHSSGNTALLLLLCVQHSFPEPSKLYLELILAVLALEL ICSLSCLILYIVKIRRFNRAKPLPDVLEEEKIYAYPSNTASETGFRTVSSLEEIVEKQED IIVYLKRHNALLSKRLLELATQPART

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Cy5 anti-human CD11c
E16FHC011c-100 100 Tests

PE-Cy5 anti-human CD11c

Sign In for Pricing
View Details
Lentiviral human PTH1R sgRNA gene knockout kit - Lentiviral human PTH1R sgRNA gene knockout kit (plasmid)
GTR15401168 1 Vial

Lentiviral human PTH1R sgRNA gene knockout kit - Lentiviral human PTH1R sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
GP1BB Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
22425066 1.0 µg DNA

GP1BB Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Goat Olfactory Receptor 10V1 (OR10V1) ELISA Kit
MBS7259260-01 48 Well

Goat Olfactory Receptor 10V1 (OR10V1) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 10V1 (OR10V1) ELISA Kit
MBS7259260-02 96 Well

Goat Olfactory Receptor 10V1 (OR10V1) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 10V1 (OR10V1) ELISA Kit
MBS7259260-03 5x 96 Well

Goat Olfactory Receptor 10V1 (OR10V1) ELISA Kit

Sign In for Pricing
View Details