Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 192 (Tmem192)

This Recombinant Mouse Transmembrane protein 192 (Tmem192) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Transmembrane protein 192

UniProt

Q9CXT7

Expression Region

1-266

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAAGRLEDSSLDILQSMDDDPLLDTQPLPHHSLQAQFRPRFHPLPTVIIANLLLLIHVV FVVLAFLTGVPCLYPNPTEDKCPENYTSPLKVQTAIILGKLILWILHLLFERYVQYHHRK VRSRGYSQIYRSTRHLKTLALTIHSSGNTALLLLLCVQHSFPEPSKLYLELILAVLALEL ICSLSCLILYIVKIRRFNRAKPLPDVLEEEKIYAYPSNTASETGFRTVSSLEEIVEKQED IIVYLKRHNALLSKRLLELATQPART

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Serine/Threonine-Protein Kinase 17B (STK17B) ELISA Kit
MBS9392914-01 48 Well

Canine Serine/Threonine-Protein Kinase 17B (STK17B) ELISA Kit

Sign In for Pricing
View Details
Canine Serine/Threonine-Protein Kinase 17B (STK17B) ELISA Kit
MBS9392914-02 96 Well

Canine Serine/Threonine-Protein Kinase 17B (STK17B) ELISA Kit

Sign In for Pricing
View Details
Canine Serine/Threonine-Protein Kinase 17B (STK17B) ELISA Kit
MBS9392914-03 5x 96 Well

Canine Serine/Threonine-Protein Kinase 17B (STK17B) ELISA Kit

Sign In for Pricing
View Details
Canine Serine/Threonine-Protein Kinase 17B (STK17B) ELISA Kit
MBS9392914-04 10x 96 Well

Canine Serine/Threonine-Protein Kinase 17B (STK17B) ELISA Kit

Sign In for Pricing
View Details
NXNL1 (TXNL6, Nucleoredoxin-like Protein 1, Thioredoxin-like Protein 6, RDCVF) (FITC)
MBS6150307-01 0.1 mL

NXNL1 (TXNL6, Nucleoredoxin-like Protein 1, Thioredoxin-like Protein 6, RDCVF) (FITC)

Sign In for Pricing
View Details
NXNL1 (TXNL6, Nucleoredoxin-like Protein 1, Thioredoxin-like Protein 6, RDCVF) (FITC)
MBS6150307-02 5x 0.1 mL

NXNL1 (TXNL6, Nucleoredoxin-like Protein 1, Thioredoxin-like Protein 6, RDCVF) (FITC)

Sign In for Pricing
View Details