Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4, Human (HEK293, Fc)

VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

VSIG4 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html

Purity

98.0

Smiles

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV

Molecular Formula

11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)

Molecular Weight

Approximately 75.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cadm3 3'UTR GFP Stable Cell Line
TU251572 1.0 mL

Cadm3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Collagen Type III (N-Terminal) antibody
FNab01838 100 µg

Collagen Type III (N-Terminal) antibody

Sign In for Pricing
View Details
Recombinant Human ANXA5 Protein, N-His
E55P6934 50 µg

Recombinant Human ANXA5 Protein, N-His

Sign In for Pricing
View Details
C10orf12 (NM_015652) Human Untagged Clone
SC112606 10 µg

C10orf12 (NM_015652) Human Untagged Clone

Sign In for Pricing
View Details
FIBCD1 Recombinant Protein Antigen
NBP2-31601PEP 0.1 mL

FIBCD1 Recombinant Protein Antigen

Sign In for Pricing
View Details
Human Sestrin-3 ELISA Kit
MBS2880080-01 48 Well

Human Sestrin-3 ELISA Kit

Sign In for Pricing
View Details