Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4, Human (HEK293, Fc)

VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

VSIG4 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html

Purity

98.0

Smiles

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV

Molecular Formula

11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)

Molecular Weight

Approximately 75.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Salmonella yuaZ Protein (aa 1-90)
VAng-Wyb1343-500gEcoli 500 µg (E. coli)

Recombinant Salmonella yuaZ Protein (aa 1-90)

Sign In for Pricing
View Details
Pstpip2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3840307 1.0 µg DNA

Pstpip2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Mouse Polyclonal LOXL1 Antibody
H00004016-B01P 0.05 mg

Mouse Polyclonal LOXL1 Antibody

Sign In for Pricing
View Details
Recombinant Human CENPP Protein, His, E.coli-20ug
QP11390-20ug 20ug

Recombinant Human CENPP Protein, His, E.coli-20ug

Sign In for Pricing
View Details
PAPOA Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-4966R-BF405 100 µL

PAPOA Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Ethyl Bromoacetate
E900140 100 g

Ethyl Bromoacetate

Sign In for Pricing
View Details