Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4, Human (HEK293, Fc)

VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

VSIG4 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html

Purity

98.0

Smiles

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV

Molecular Formula

11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)

Molecular Weight

Approximately 75.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human anti-Exo m 1 IgE
E4A11B90-E 50 µg

Human anti-Exo m 1 IgE

Sign In for Pricing
View Details
PLIN3 Polyclonal Antibody
JOT-AP13173-01 50ul

PLIN3 Polyclonal Antibody

Sign In for Pricing
View Details
PLIN3 Polyclonal Antibody
JOT-AP13173-02 100ul

PLIN3 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Contactin-2/TAG1 Antibody [DyLight 650]
NBP2-99312C 0.1 mL

Rabbit Polyclonal Contactin-2/TAG1 Antibody [DyLight 650]

Sign In for Pricing
View Details
Murashige & Skoog Basal Salts With Macronutrients, Micronutrients, Vitamins and 30g/L Sucrose
MSP14-10LT 10 L

Murashige & Skoog Basal Salts With Macronutrients, Micronutrients, Vitamins and 30g/L Sucrose

Sign In for Pricing
View Details
EIF2B4 Antibody
A25352-50UG 50 µg

EIF2B4 Antibody

Sign In for Pricing
View Details