Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4, Human (HEK293, Fc)

VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

VSIG4 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html

Purity

98.0

Smiles

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV

Molecular Formula

11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)

Molecular Weight

Approximately 75.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C14orf55 3'UTR GFP Stable Cell Line
TU052882 1.0 mL

C14orf55 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Giot1 ORF Vector (Rat) (pORF)
ORF067550 1.0 µg DNA

Giot1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Ms4a6b sgRNA CRISPR Lentivector (Rat) (Target 2)
K7239603 1.0 µg DNA

Ms4a6b sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
PRKCH Human Pre-designed siRNA Set A
HY-RS11131 1 Set

PRKCH Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Isyna1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3281508 1.0 µg DNA

Isyna1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Silver sulfate
HY-W051140-01 5 g

Silver sulfate

Sign In for Pricing
View Details