VSIG4, Human (HEK293, Fc)
VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
VSIG4 Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html
Purity
98.0
Smiles
RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV
Molecular Formula
11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)
Molecular Weight
Approximately 75.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS724364-01 48 Well
Rat Squamous Cell Carcinoma Antigen 2 ELISA Kit
Sign In for Pricing
View Details 
MBS724364-02 96 Well
Rat Squamous Cell Carcinoma Antigen 2 ELISA Kit
Sign In for Pricing
View Details 
MBS724364-03 5x 96 Well
Rat Squamous Cell Carcinoma Antigen 2 ELISA Kit
Sign In for Pricing
View Details MBS724364-04 10x 96 Well
Rat Squamous Cell Carcinoma Antigen 2 ELISA Kit
Sign In for Pricing
View Details 