Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4, Human (HEK293, Fc)

VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

VSIG4 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html

Purity

98.0

Smiles

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV

Molecular Formula

11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)

Molecular Weight

Approximately 75.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERF1A Recombinant Protein Antigen
NBP2-57943PEP 100 µL

SERF1A Recombinant Protein Antigen

Sign In for Pricing
View Details
SB-743921
E4595-100mg 100 mg

SB-743921

Sign In for Pricing
View Details
Recombinant Shigella Dysenteriae rplJ Protein (aa 1-165)
VAng-Lsx07130-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Dysenteriae rplJ Protein (aa 1-165)

Sign In for Pricing
View Details
Endoplasmic reticulum resident Protein 29 (FITC)
314793-01 50 µg

Endoplasmic reticulum resident Protein 29 (FITC)

Sign In for Pricing
View Details
Endoplasmic reticulum resident Protein 29 (FITC)
314793-02 100 µg

Endoplasmic reticulum resident Protein 29 (FITC)

Sign In for Pricing
View Details
ZNF653 CRISPR Knock Out 293T Cell Line (Human)
51700141 1x 10^6 Cells / 1.0 mL

ZNF653 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details