Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4, Human (HEK293, Fc)

VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

VSIG4 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html

Purity

98.0

Smiles

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV

Molecular Formula

11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)

Molecular Weight

Approximately 75.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHMP1A Antibody
A44657-50UL 50 μL

CHMP1A Antibody

Sign In for Pricing
View Details
Recombinant Rhesus Macaque PTEN Protein, His (Fc)-Avi-tagged
PTEN-3504R 50 µg

Recombinant Rhesus Macaque PTEN Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Tiaprofenic acid 10mg
A17720-10 10 mg

Tiaprofenic acid 10mg

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) RIE1 Polyclonal Antibody
MBS9002044 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) RIE1 Polyclonal Antibody

Sign In for Pricing
View Details
PHF11 (NM_001040443) Human Over-expression Lysate
LS051131-100ug 100 µg

PHF11 (NM_001040443) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Monoclonal IL-11 Antibody (22626) [DyLight 680]
FAB218Y 0.5 mL

Mouse Monoclonal IL-11 Antibody (22626) [DyLight 680]

Sign In for Pricing
View Details