Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4, Human (HEK293, Fc)

VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

VSIG4 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html

Purity

98.0

Smiles

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV

Molecular Formula

11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)

Molecular Weight

Approximately 75.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPAP2B Protein Vector (Mouse) (pPB-N-His)
PV218167 500 ng

PPAP2B Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Tef (BC017689) AAV Particle
MR203666A1V 250 µL

Mouse Tef (BC017689) AAV Particle

Sign In for Pricing
View Details
Mouse Monoclonal HLA DRB1 Antibody (rHLA-DRB/7198) [CoraFluor 1]
NBP3-20840CL1 0.1 mL

Mouse Monoclonal HLA DRB1 Antibody (rHLA-DRB/7198) [CoraFluor 1]

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPI) Rabbit Polyclonal Antibody
TA358463 100 µL

Alkaline Phosphatase (ALPI) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ms4a4c (NM_001106339) Rat Tagged Lenti ORF Clone
RR205461L4 10 µg

Ms4a4c (NM_001106339) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
WNT7B (Protein Wnt-7b) BioAssayTM ELISA Kit (Human) discontinued
359692-01 48 Tests

WNT7B (Protein Wnt-7b) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details