Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4, Human (HEK293, Fc)

VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

VSIG4 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html

Purity

98.0

Smiles

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV

Molecular Formula

11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)

Molecular Weight

Approximately 75.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Binedaline
TRC-B387100-1G 1 g

Binedaline

Sign In for Pricing
View Details
Zfp839 (NM_028365) Mouse Tagged ORF Clone
MG213084 10 µg

Zfp839 (NM_028365) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CT47A8 Human shRNA Plasmid Kit (Locus ID 728049)
TL320849 1 Kit

CT47A8 Human shRNA Plasmid Kit (Locus ID 728049)

Sign In for Pricing
View Details
ZNF226 CytoSection
TS401024P5 25 Slides

ZNF226 CytoSection

Sign In for Pricing
View Details
Galactomannan (GM) Human ELISA Kit
95492 96 Tests

Galactomannan (GM) Human ELISA Kit

Sign In for Pricing
View Details
Mouse FK506 Binding Protein Like Protein (FKBPL) ELISA Kit
RD-FKBPL-Mu-48Tests 48 Tests

Mouse FK506 Binding Protein Like Protein (FKBPL) ELISA Kit

Sign In for Pricing
View Details