Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4, Human (HEK293, Fc)

VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, Fc) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

VSIG4 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vsig4-protein-human-hek-293-fc.html

Purity

98.0

Smiles

RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPV

Molecular Formula

11326 (Gene_ID) Q9Y279-1 (R20-V284) (Accession)

Molecular Weight

Approximately 75.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OKCA01104-96W - Tissue Transglutaminase Antibody (IgG) (Human) ELISA Kit
OKCA01104-96W 96 Well

OKCA01104-96W - Tissue Transglutaminase Antibody (IgG) (Human) ELISA Kit

Sign In for Pricing
View Details
MYBBP1A Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61691R-BF405-01 20 µL

MYBBP1A Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
MYBBP1A Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61691R-BF405-02 100 µL

MYBBP1A Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Human B4GALT7 Knockout HEK293T cell line
GTR15412209 1 Vial

Human B4GALT7 Knockout HEK293T cell line

Sign In for Pricing
View Details
Monkey Troponin I Type 1, Slow Skeletal Muscle ELISA Kit
MBS7263245-01 48 Well

Monkey Troponin I Type 1, Slow Skeletal Muscle ELISA Kit

Sign In for Pricing
View Details
Monkey Troponin I Type 1, Slow Skeletal Muscle ELISA Kit
MBS7263245-02 96 Well

Monkey Troponin I Type 1, Slow Skeletal Muscle ELISA Kit

Sign In for Pricing
View Details