Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kit ligand (KITLG), partial , Active Protein

Recombinant Human Kit ligand (KITLG), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Kit ligand (KITLG) . Accession Number: P21583; KITLG. Expression Region: 26-214aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 22kda. Target Synonyms: Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cell Factor; SCF; c-Kit ligand; KITLG; MGF; SCF Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Kit ligand (KITLG), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P21583; KITLG

Expression Region

26-214aa

Host

Mammalian Cells

Target

Kit ligand (KITLG)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cell Factor; SCF; c-Kit ligand; KITLG; MGF; SCF

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTR9 Rabbit pAb (APR25282N)
APR25282N-01 50 µL

CTR9 Rabbit pAb (APR25282N)

Sign In for Pricing
View Details
CTR9 Rabbit pAb (APR25282N)
APR25282N-02 100 µL

CTR9 Rabbit pAb (APR25282N)

Sign In for Pricing
View Details
CTR9 Rabbit pAb (APR25282N)
APR25282N-03 200 µL

CTR9 Rabbit pAb (APR25282N)

Sign In for Pricing
View Details
Mal (NM_001171187) Mouse Tagged Lenti ORF Clone
MR219326L3 10 µg

Mal (NM_001171187) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Collagen petide (Fish)
HY-NP0219 1 Each

Collagen petide (Fish)

Sign In for Pricing
View Details
Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) RIM13 Polyclonal Antibody
MBS7199396 Inquire

Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) RIM13 Polyclonal Antibody

Sign In for Pricing
View Details