Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kit ligand (KITLG), partial , Active Protein

Recombinant Human Kit ligand (KITLG), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Kit ligand (KITLG) . Accession Number: P21583; KITLG. Expression Region: 26-214aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 22kda. Target Synonyms: Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cell Factor; SCF; c-Kit ligand; KITLG; MGF; SCF Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Kit ligand (KITLG), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P21583; KITLG

Expression Region

26-214aa

Host

Mammalian Cells

Target

Kit ligand (KITLG)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cell Factor; SCF; c-Kit ligand; KITLG; MGF; SCF

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IgE Antibody (4G7) [Janelia Fluor 646]
NB500-471JF646 0.1 mL

Mouse Monoclonal IgE Antibody (4G7) [Janelia Fluor 646]

Sign In for Pricing
View Details
Cntn6 Mouse Pre-designed siRNA Set A
HY-RS20385 1 Set

Cntn6 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Spark NIR™ 685 anti-mouse Ki-67
GT19177 100 µg

Spark NIR™ 685 anti-mouse Ki-67

Sign In for Pricing
View Details
Human DOK5 Pre-designed siRNA Set A
SI004496A 1 Each

Human DOK5 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Monoclonal ADAM15 Antibody (027) [DyLight 488]
NBP2-89548G 0.1 mL

Rabbit Monoclonal ADAM15 Antibody (027) [DyLight 488]

Sign In for Pricing
View Details
putative thymidine kinase (NC_003494) Virus Tagged ORF Clone
VC102322 10 µg

putative thymidine kinase (NC_003494) Virus Tagged ORF Clone

Sign In for Pricing
View Details