Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDI2 Protein Vector (Rat) (pPM-C-HA)

Product Specifications

No additional specifications available.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ribonuclease Inhibitor (RNH1) (NM_203384) Human Untagged Clone
SC308148 10 µg

Ribonuclease Inhibitor (RNH1) (NM_203384) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant Human Protein mono-ADP-ribosyltransferase PARP16 (PARP16), partial
CSB-EP836673HU-01 20 µg

Recombinant Human Protein mono-ADP-ribosyltransferase PARP16 (PARP16), partial

Sign In for Pricing
View Details
Recombinant Human Protein mono-ADP-ribosyltransferase PARP16 (PARP16), partial
CSB-EP836673HU-02 100 µg

Recombinant Human Protein mono-ADP-ribosyltransferase PARP16 (PARP16), partial

Sign In for Pricing
View Details
Recombinant Human Protein mono-ADP-ribosyltransferase PARP16 (PARP16), partial
CSB-EP836673HU-03 1 mg

Recombinant Human Protein mono-ADP-ribosyltransferase PARP16 (PARP16), partial

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MF-0155879-01 5 mg

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MF-0155879-02 50 mg

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details