Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

CAS Number

2279952-25-7

Target

IGluR

Related Pathways

Membrane transporter/Ion channel|||Neuroscience

Bioactivity

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, a 30-amino-acid peptide, mirrors the C-terminal domain of ?2?-1 and is recognized as the ?2?-1Tat peptide. It disrupts the ?2?-1 - NMDAR interaction both in vitro and in vivo, offering a potential research tool for neuropathic pain studies [1].

Smiles

C([C@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC1=CC=CC=C1)NC([C@@H](NC([C@@H](NC(CNC([C@H](CC2=CC=CC=C2)NC([C@@H](NC([C@@H](NC([C@H](CC=3C=4C(NC3)=CC=CC4)NC([C@@H](NC([C@@H](NC(=O)[C@H]5N(C([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@H](C(C)C)N)=O)CO)=O)=O)CC(C)C)=O)CC(N)=O)=O)CCC5)CO)=O)CC(C)C)=O)=O)CO)=O)[C@H](CC)C)=O)=O)=O)CC(C)C)=O)CCC(N)=O)=O)=O)[C@H](CC)C)=O)CC(C)C)=O)CC(C)C)=O)C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@@H](CC6=CN=CN6)C(N[C@@H](CC7=CC=C(O)C=C7)C(N[C@H](C(N[C@@H](CC=8C=9C(NC8)=CC=CC9)C(O)=O)=O)CC(C)C)=O)=O)=O)CCCNC(=N)N)=O)CO)=O)=O)CO)=O)C(C)C)=O)CC(C)C)=O)C=%10C=%11C(NC%10)=CC=CC%11

Molecular Formula

C171H250N40O39

Molecular Weight

3490.06

Shipping Conditions

Cool pack

Storage Temperature

-20°C

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIRT6 Recombinant Rabbit Monoclonal Antibody [JJ20-69]
ET1701-29 100 µL

SIRT6 Recombinant Rabbit Monoclonal Antibody [JJ20-69]

Sign In for Pricing
View Details
Human IL-17A/F ELISA Set, 15 x 96-well
EA101390 15x 96 Well

Human IL-17A/F ELISA Set, 15 x 96-well

Sign In for Pricing
View Details
Canine T-H Glycoprotein ELISA Kit
MBS010151-01 48 Well

Canine T-H Glycoprotein ELISA Kit

Sign In for Pricing
View Details
Canine T-H Glycoprotein ELISA Kit
MBS010151-02 96 Well

Canine T-H Glycoprotein ELISA Kit

Sign In for Pricing
View Details
Canine T-H Glycoprotein ELISA Kit
MBS010151-03 5x 96 Well

Canine T-H Glycoprotein ELISA Kit

Sign In for Pricing
View Details
Canine T-H Glycoprotein ELISA Kit
MBS010151-04 10x 96 Well

Canine T-H Glycoprotein ELISA Kit

Sign In for Pricing
View Details