Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Product Specifications

CAS Number

2279952-25-7

Target

IGluR

Related Pathways

Membrane transporter/Ion channel|||Neuroscience

Bioactivity

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW, a 30-amino-acid peptide, mirrors the C-terminal domain of ?2?-1 and is recognized as the ?2?-1Tat peptide. It disrupts the ?2?-1 - NMDAR interaction both in vitro and in vivo, offering a potential research tool for neuropathic pain studies [1].

Smiles

C([C@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC1=CC=CC=C1)NC([C@@H](NC([C@@H](NC(CNC([C@H](CC2=CC=CC=C2)NC([C@@H](NC([C@@H](NC([C@H](CC=3C=4C(NC3)=CC=CC4)NC([C@@H](NC([C@@H](NC(=O)[C@H]5N(C([C@@H](NC([C@@H](NC(CNC([C@@H](NC([C@H](C(C)C)N)=O)CO)=O)=O)CC(C)C)=O)CC(N)=O)=O)CCC5)CO)=O)CC(C)C)=O)=O)CO)=O)[C@H](CC)C)=O)=O)=O)CC(C)C)=O)CCC(N)=O)=O)=O)[C@H](CC)C)=O)CC(C)C)=O)CC(C)C)=O)C(N[C@H](C(N[C@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@@H](CC6=CN=CN6)C(N[C@@H](CC7=CC=C(O)C=C7)C(N[C@H](C(N[C@@H](CC=8C=9C(NC8)=CC=CC9)C(O)=O)=O)CC(C)C)=O)=O)=O)CCCNC(=N)N)=O)CO)=O)=O)CO)=O)C(C)C)=O)CC(C)C)=O)C=%10C=%11C(NC%10)=CC=CC%11

Molecular Formula

C171H250N40O39

Molecular Weight

3490.06

Shipping Conditions

Cool pack

Storage Temperature

-20°C

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Zinc finger CCCH domain-containing Protein 15, ZC3H15 GENLISA ELISA
KLR0783 96 Well

Rat Zinc finger CCCH domain-containing Protein 15, ZC3H15 GENLISA ELISA

Sign In for Pricing
View Details
Human SHLD2 Pre-designed siRNA Set A
SI014747A 1 Each

Human SHLD2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
RASSF1 (NM_170714) Human Tagged ORF Clone
RC221518 10 µg

RASSF1 (NM_170714) Human Tagged ORF Clone

Sign In for Pricing
View Details
C10orf132 Peptide - N-terminal region
MBS3236602-01 0.1 mg

C10orf132 Peptide - N-terminal region

Sign In for Pricing
View Details
C10orf132 Peptide - N-terminal region
MBS3236602-02 5x 0.1 mg

C10orf132 Peptide - N-terminal region

Sign In for Pricing
View Details
Mouse Gnpda1 Pre-designed siRNA Set A
SI105650A 1 Each

Mouse Gnpda1 Pre-designed siRNA Set A

Sign In for Pricing
View Details