Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A1P4 Protein Vector (Human) (pPM-C-His)

Product Specifications

No additional specifications available.

More Discoveries

Explore Other Products

Browse additional items from our catalog

4’-Benzyloxy-3’-nitroacetophenone
TRC-B287010-250MG 250 mg

4’-Benzyloxy-3’-nitroacetophenone

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) Mouse Monoclonal Antibody [Clone ID: 105G7]
TA355331 1 mL

Parathyroid Hormone (PTH) Mouse Monoclonal Antibody [Clone ID: 105G7]

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Photosystem II reaction center protein T (psbT), partial
MBS7076291 Inquire

Recombinant Synechococcus sp. Photosystem II reaction center protein T (psbT), partial

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MF-0155879-01 5 mg

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MF-0155879-02 50 mg

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
Granulocyte (MaxLight 650)
138554-AF-ML650 100 µL

Granulocyte (MaxLight 650)

Sign In for Pricing
View Details