Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX14 Protein Vector (Human) (pPB-C-His)

Product Specifications

No additional specifications available.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Complement Component C3a R Antibody (3G7) [Alexa Fluor 532]
NBP2-52674AF532 0.1 mL

Rabbit Monoclonal Complement Component C3a R Antibody (3G7) [Alexa Fluor 532]

Sign In for Pricing
View Details
Phospho-STAT3 (Tyr705) Polyclonal Antibody, FITC Conjugated
bs-22386R-FITC 100 µL

Phospho-STAT3 (Tyr705) Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Tat Rabbit Polyclonal Antibody
TA356720 100 µL

Tat Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Heptadecan-9-yl 8- ((2-hydroxyethyl) amino) octanoate
FH00561 250 g

Heptadecan-9-yl 8- ((2-hydroxyethyl) amino) octanoate

Sign In for Pricing
View Details
H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH
PH00066-01 1 mg

H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH

Sign In for Pricing
View Details
H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH
PH00066-02 10 mg

H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH

Sign In for Pricing
View Details