Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH

Product Specifications

Synonyms

H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-Gly-Le u-Gly-Ser-Pro-Arg-Ser-acid; Endothelin 1 (Big) (1-39) (human)

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 4-hydroxy-2-naphthoate
OR1056999-01 100 mg

Ethyl 4-hydroxy-2-naphthoate

Sign In for Pricing
View Details
Ethyl 4-hydroxy-2-naphthoate
OR1056999-02 250 mg

Ethyl 4-hydroxy-2-naphthoate

Sign In for Pricing
View Details
Ethyl 4-hydroxy-2-naphthoate
OR1056999-03 1 g

Ethyl 4-hydroxy-2-naphthoate

Sign In for Pricing
View Details
Mouse Melanoma Cells Transfected+Ova
AFG-ELL-3848 > 1x 10^6 Cells / Vial

Mouse Melanoma Cells Transfected+Ova

Sign In for Pricing
View Details
Human SMIM3 Knockout HEK293T cell line
GTR15402066 1 Vial

Human SMIM3 Knockout HEK293T cell line

Sign In for Pricing
View Details
IYD Rabbit Polyclonal Antibody (Biotin)
orb2089966 100 µL

IYD Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details