Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH

Product Specifications

Synonyms

H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-Gly-Le u-Gly-Ser-Pro-Arg-Ser-acid; Endothelin 1 (Big) (1-39) (human)

Controlled

No

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-138-2-3p Primers
MPH02189 150 µL / 10 µM

hsa-miR-138-2-3p Primers

Sign In for Pricing
View Details
Poultry Mycoplasma Synoviae (MS) ELISA Kit
SL0068Ot-01 48 Tests

Poultry Mycoplasma Synoviae (MS) ELISA Kit

Sign In for Pricing
View Details
Poultry Mycoplasma Synoviae (MS) ELISA Kit
SL0068Ot-02 96 Tests

Poultry Mycoplasma Synoviae (MS) ELISA Kit

Sign In for Pricing
View Details
SNUPN Peptide - middle region (AAP40598)
AAP40598-100UG 100 µg

SNUPN Peptide - middle region (AAP40598)

Sign In for Pricing
View Details
Human Alpha-Actinin 3 (ACTN-3) ELISA Kit
RK07658 96 Tests

Human Alpha-Actinin 3 (ACTN-3) ELISA Kit

Sign In for Pricing
View Details
Rat Monoclonal CD5 Antibody (53-7.3) [DyLight 405]
FAB115E 0.5 mL

Rat Monoclonal CD5 Antibody (53-7.3) [DyLight 405]

Sign In for Pricing
View Details