Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat C-C Motif Chemokine 5/CCL5 (N-6His)

Source: E.coli. MW :10kD. Recombinant Rat C-C motif chemokine 5 is produced by our E.coli expression system and the target gene encoding Ser25-Ser92 is expressed with a 6His tag at the N-terminus. C-C motif chemokine 5 (CCL5) is a beta-chemokine that plays a primary role in the inflammatory immune response by means of its ability to attract and activate leukocytes. CCL5 is secreted by many cell types at inflammatory sites, and it exerts a wide range of activities through the receptors CCR1, CCR3, CCR4, and CCR5. Inflammatory responses can be impaired by the sequestration of CCL5 by the cytomegalovirus protein US28. Oligomerization of CCL5 on glycosaminoglycans is required for CCR1mediated leukocyte adhesion and activation as well as CCL5â€TMs interaction with the chemokine CXCL4/PF4.The deposition of CCL5 on activated vascular endothelial cells is crucial for monocyte adhesion to damaged vasculature, but CCL5 oligomerization is not required for the extravasation of adherent leukocytes.CCL5 is upregulated in breast cancer and promotes tumor progression through the attraction of proinflammatory macrophages in addition to its actions on tumor cells, stromal cells, and the vasculature.

Product Specifications

Gene Name

Ccl5

UniProt

P50231

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 500mM NaCl, 2mM EDTA, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MNHKVHHHHHHMDDDDKSPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) eft201 Polyclonal Antibody
MBS7138948 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) eft201 Polyclonal Antibody

Sign In for Pricing
View Details
Acvr1c (Activin Receptor Type-1C, Activin Receptor Type IC, ACTR-IC, Activin Receptor-like Kinase 7, ALK-7, Alk7) discontinued
029714 100 µg

Acvr1c (Activin Receptor Type-1C, Activin Receptor Type IC, ACTR-IC, Activin Receptor-like Kinase 7, ALK-7, Alk7) discontinued

Sign In for Pricing
View Details
Adenovirus (PE)
A0876-50A-PE 100 µL

Adenovirus (PE)

Sign In for Pricing
View Details
CNR2, Human (Cell-Free, His)
HY-P702255-01 20 µg

CNR2, Human (Cell-Free, His)

Sign In for Pricing
View Details
CNR2, Human (Cell-Free, His)
HY-P702255-02 50 µg

CNR2, Human (Cell-Free, His)

Sign In for Pricing
View Details
MET Protein (N-GST, Human)
P526758 100 µg

MET Protein (N-GST, Human)

Sign In for Pricing
View Details