Recombinant Rat C-C Motif Chemokine 5/CCL5 (N-6His)
Source: E.coli. MW :10kD. Recombinant Rat C-C motif chemokine 5 is produced by our E.coli expression system and the target gene encoding Ser25-Ser92 is expressed with a 6His tag at the N-terminus. C-C motif chemokine 5 (CCL5) is a beta-chemokine that plays a primary role in the inflammatory immune response by means of its ability to attract and activate leukocytes. CCL5 is secreted by many cell types at inflammatory sites, and it exerts a wide range of activities through the receptors CCR1, CCR3, CCR4, and CCR5. Inflammatory responses can be impaired by the sequestration of CCL5 by the cytomegalovirus protein US28. Oligomerization of CCL5 on glycosaminoglycans is required for CCR1mediated leukocyte adhesion and activation as well as CCL5â€TMs interaction with the chemokine CXCL4/PF4.The deposition of CCL5 on activated vascular endothelial cells is crucial for monocyte adhesion to damaged vasculature, but CCL5 oligomerization is not required for the extravasation of adherent leukocytes.CCL5 is upregulated in breast cancer and promotes tumor progression through the attraction of proinflammatory macrophages in addition to its actions on tumor cells, stromal cells, and the vasculature.
Product Specifications
Gene Name
Ccl5
UniProt
P50231
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 500mM NaCl, 2mM EDTA, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
MNHKVHHHHHHMDDDDKSPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
Explore Other Products
Browse additional items from our catalog