Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2, Human (Cell-Free, His)

CNR2 Protein, a heterotrimeric G protein-coupled receptor, crucially inhibits adenylate cyclase, mediating functions in inflammatory responses, nociceptive transmission, and bone homeostasis. Its modulation of cellular signaling underscores its significance in physiological processes, positioning CNR2 Protein as a key regulator in inflammatory, sensory mechanisms, and bone equilibrium. CNR2 Protein, Human (Cell-Free, His) is the recombinant human-derived CNR2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

CNR2 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-human-cf-his.html

Purity

90.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

42.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

QRFPR Antibody
A41706-50UG 50 µg

QRFPR Antibody

Sign In for Pricing
View Details
Rabbit SPD (Pulmonary Surfactant Associated Protein D) ValidElisa Kit
EK346022 96 Well

Rabbit SPD (Pulmonary Surfactant Associated Protein D) ValidElisa Kit

Sign In for Pricing
View Details
GDC-0941
GW4351-10mg 10 mg

GDC-0941

Sign In for Pricing
View Details
Human Steryl-sulfatase ELISA Kit
MBS9428805-01 96 Tests

Human Steryl-sulfatase ELISA Kit

Sign In for Pricing
View Details
Human Steryl-sulfatase ELISA Kit
MBS9428805-02 5x 96 Tests

Human Steryl-sulfatase ELISA Kit

Sign In for Pricing
View Details
S100A7 Polyclonal Antibody, APC Conjugated
bs-6575R-APC-01 20 µL

S100A7 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details