Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2, Human (Cell-Free, His)

CNR2 Protein, a heterotrimeric G protein-coupled receptor, crucially inhibits adenylate cyclase, mediating functions in inflammatory responses, nociceptive transmission, and bone homeostasis. Its modulation of cellular signaling underscores its significance in physiological processes, positioning CNR2 Protein as a key regulator in inflammatory, sensory mechanisms, and bone equilibrium. CNR2 Protein, Human (Cell-Free, His) is the recombinant human-derived CNR2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

CNR2 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-human-cf-his.html

Purity

90.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

42.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C11orf68 Overexpression Lysate (Native) - (Dry Ice)
NBL1-08116 0.1 mg

C11orf68 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
RENBP Human qPCR Primer Pair (NM_002910)
HP206523 200 Reactions

RENBP Human qPCR Primer Pair (NM_002910)

Sign In for Pricing
View Details
2-Deoxy-D-erythro-pentopyranosyl Chloride Bis (4-methylbenzoate) (Decitabine Impurity) (Mixture of α/β isomers) discontinued
417402-01 1 g

2-Deoxy-D-erythro-pentopyranosyl Chloride Bis (4-methylbenzoate) (Decitabine Impurity) (Mixture of α/β isomers) discontinued

Sign In for Pricing
View Details
2-Deoxy-D-erythro-pentopyranosyl Chloride Bis (4-methylbenzoate) (Decitabine Impurity) (Mixture of α/β isomers) discontinued
417402-02 10 g

2-Deoxy-D-erythro-pentopyranosyl Chloride Bis (4-methylbenzoate) (Decitabine Impurity) (Mixture of α/β isomers) discontinued

Sign In for Pricing
View Details
Anti-AMCase Rabbit pAb
GB113637-100 100 μL

Anti-AMCase Rabbit pAb

Sign In for Pricing
View Details
URI1 Polyclonal Antibody
MBS8567092-01 0.1 mL

URI1 Polyclonal Antibody

Sign In for Pricing
View Details