Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2, Human (Cell-Free, His)

CNR2 Protein, a heterotrimeric G protein-coupled receptor, crucially inhibits adenylate cyclase, mediating functions in inflammatory responses, nociceptive transmission, and bone homeostasis. Its modulation of cellular signaling underscores its significance in physiological processes, positioning CNR2 Protein as a key regulator in inflammatory, sensory mechanisms, and bone equilibrium. CNR2 Protein, Human (Cell-Free, His) is the recombinant human-derived CNR2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

CNR2 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-human-cf-his.html

Purity

90.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

42.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SKP2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
43849151 3x 1.0 µg DNA

SKP2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Recombinant Human Orexin-A protein (TRX,His tag)
MBS2570725-01 0.02 mg

Recombinant Human Orexin-A protein (TRX,His tag)

Sign In for Pricing
View Details
Recombinant Human Orexin-A protein (TRX,His tag)
MBS2570725-02 0.1 mg

Recombinant Human Orexin-A protein (TRX,His tag)

Sign In for Pricing
View Details
Recombinant Human Orexin-A protein (TRX,His tag)
MBS2570725-03 5x 0.1 mg

Recombinant Human Orexin-A protein (TRX,His tag)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus ATP synthase subunit delta (atpH)
MBS1348304-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus ATP synthase subunit delta (atpH)
MBS1348304-02 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus ATP synthase subunit delta (atpH)

Sign In for Pricing
View Details