Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2, Human (Cell-Free, His)

CNR2 Protein, a heterotrimeric G protein-coupled receptor, crucially inhibits adenylate cyclase, mediating functions in inflammatory responses, nociceptive transmission, and bone homeostasis. Its modulation of cellular signaling underscores its significance in physiological processes, positioning CNR2 Protein as a key regulator in inflammatory, sensory mechanisms, and bone equilibrium. CNR2 Protein, Human (Cell-Free, His) is the recombinant human-derived CNR2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

CNR2 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-human-cf-his.html

Purity

90.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

42.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIT1 (Tyr510) (ARF GTPase-activating protein GIT1, G protein-coupled receptor kinase-interactor 1, GRK-interacting protein 1, Cool-associated and tyrosine-phosphorylated protein 1, Cat-1, GIT1) (APC) discontinued
G2035-07M-APC 200 µL

GIT1 (Tyr510) (ARF GTPase-activating protein GIT1, G protein-coupled receptor kinase-interactor 1, GRK-interacting protein 1, Cool-associated and tyrosine-phosphorylated protein 1, Cat-1, GIT1) (APC) discontinued

Sign In for Pricing
View Details
MRPS34 Mouse Monoclonal Antibody [Clone ID: OTI4C4]
CF505232 100 µg

MRPS34 Mouse Monoclonal Antibody [Clone ID: OTI4C4]

Sign In for Pricing
View Details
Jionoside B1 discontinued
371615 5 mg

Jionoside B1 discontinued

Sign In for Pricing
View Details
ELF3 (E74-like Factor 3, ets Domain Transcription Factor, Epithelial-specific, EPR-1, ERT, ESE-1, ESX) (MaxLight 550)
MBS6446345-01 0.1 mL

ELF3 (E74-like Factor 3, ets Domain Transcription Factor, Epithelial-specific, EPR-1, ERT, ESE-1, ESX) (MaxLight 550)

Sign In for Pricing
View Details
ELF3 (E74-like Factor 3, ets Domain Transcription Factor, Epithelial-specific, EPR-1, ERT, ESE-1, ESX) (MaxLight 550)
MBS6446345-02 5x 0.1 mL

ELF3 (E74-like Factor 3, ets Domain Transcription Factor, Epithelial-specific, EPR-1, ERT, ESE-1, ESX) (MaxLight 550)

Sign In for Pricing
View Details
C19orf54 Polyclonal Antibody, Cy7 Conjugated
bs-9684R-Cy7 100 µL

C19orf54 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details