Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2, Human (Cell-Free, His)

CNR2 Protein, a heterotrimeric G protein-coupled receptor, crucially inhibits adenylate cyclase, mediating functions in inflammatory responses, nociceptive transmission, and bone homeostasis. Its modulation of cellular signaling underscores its significance in physiological processes, positioning CNR2 Protein as a key regulator in inflammatory, sensory mechanisms, and bone equilibrium. CNR2 Protein, Human (Cell-Free, His) is the recombinant human-derived CNR2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

CNR2 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-human-cf-his.html

Purity

90.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

42.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNRPN (NM_022805) Human Recombinant Protein
PH34644M5 20 µg

SNRPN (NM_022805) Human Recombinant Protein

Sign In for Pricing
View Details
Dmbx1 (NM_130865) Mouse Tagged Lenti ORF Clone
MR223179L3 10 µg

Dmbx1 (NM_130865) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Fatty Acid Binding Protein 2, Intestinal (FABP2) Antibody Pair
abx370042-01 5x 96 Tests

Fatty Acid Binding Protein 2, Intestinal (FABP2) Antibody Pair

Sign In for Pricing
View Details
Fatty Acid Binding Protein 2, Intestinal (FABP2) Antibody Pair
abx370042-02 10x 96 Tests

Fatty Acid Binding Protein 2, Intestinal (FABP2) Antibody Pair

Sign In for Pricing
View Details
Vps25 Mouse shRNA Plasmid (Locus ID 28084)
TR502745 1 Kit

Vps25 Mouse shRNA Plasmid (Locus ID 28084)

Sign In for Pricing
View Details
Rat EFHD2 shRNA Plasmid
abx988940-01 150 µg

Rat EFHD2 shRNA Plasmid

Sign In for Pricing
View Details