Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2, Human (Cell-Free, His)

CNR2 Protein, a heterotrimeric G protein-coupled receptor, crucially inhibits adenylate cyclase, mediating functions in inflammatory responses, nociceptive transmission, and bone homeostasis. Its modulation of cellular signaling underscores its significance in physiological processes, positioning CNR2 Protein as a key regulator in inflammatory, sensory mechanisms, and bone equilibrium. CNR2 Protein, Human (Cell-Free, His) is the recombinant human-derived CNR2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

CNR2 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-human-cf-his.html

Purity

90.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

42.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-C14orf166 Antibody, Affinity Purified
A305-804A 100 µg

Rabbit anti-C14orf166 Antibody, Affinity Purified

Sign In for Pricing
View Details
Tomatidine hydrochloride 10mg
A22284-10 10 mg

Tomatidine hydrochloride 10mg

Sign In for Pricing
View Details
Recombinant Human beta-Synuclein Active, Monomer Protein - (Dry Ice)
NBP3-14775-500ug 5x 100 µg Vials

Recombinant Human beta-Synuclein Active, Monomer Protein - (Dry Ice)

Sign In for Pricing
View Details
KHDC1L (NM_001126063) Human Tagged Lenti ORF Clone
RC225082L3 10 µg

KHDC1L (NM_001126063) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Fam167b (NM_182783) Mouse Tagged ORF Clone Lentiviral Particle
MR200097L3V 200 µL

Fam167b (NM_182783) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
3-[ (2,6-Dichlorophenyl) methyl]azetidine
272059-01 100 mg

3-[ (2,6-Dichlorophenyl) methyl]azetidine

Sign In for Pricing
View Details