Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2, Human (Cell-Free, His)

CNR2 Protein, a heterotrimeric G protein-coupled receptor, crucially inhibits adenylate cyclase, mediating functions in inflammatory responses, nociceptive transmission, and bone homeostasis. Its modulation of cellular signaling underscores its significance in physiological processes, positioning CNR2 Protein as a key regulator in inflammatory, sensory mechanisms, and bone equilibrium. CNR2 Protein, Human (Cell-Free, His) is the recombinant human-derived CNR2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

CNR2 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-human-cf-his.html

Purity

90.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

42.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Antibody / HCAM
V8249-100UG 100 µg

CD44 Antibody / HCAM

Sign In for Pricing
View Details
Integrin alpha 5 (ITGA5) Rabbit Monoclonal Antibody
TA422846 100 µL

Integrin alpha 5 (ITGA5) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CNOT3 shRNA Plasmid (h)
sc-72939-SH 20 µg

CNOT3 shRNA Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human LGALS9 protein, His-tagged
LGALS9-445H 50 µg

Recombinant Human LGALS9 protein, His-tagged

Sign In for Pricing
View Details
8-Channel MicroPette Plus, 50-300μl
713112120000 1 System

8-Channel MicroPette Plus, 50-300μl

Sign In for Pricing
View Details
UBA7 (Ubiquitin-like Modifier-activating Enzyme 7, Ubiquitin-activating Enzyme 7, D8, Ubiquitin-activating Enzyme E1 Homolog, UBE1L, UBE2, UBA1B) (PE)
134973-PE 100 µL

UBA7 (Ubiquitin-like Modifier-activating Enzyme 7, Ubiquitin-activating Enzyme 7, D8, Ubiquitin-activating Enzyme E1 Homolog, UBE1L, UBE2, UBA1B) (PE)

Sign In for Pricing
View Details