Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNR2, Human (Cell-Free, His)

CNR2 Protein, a heterotrimeric G protein-coupled receptor, crucially inhibits adenylate cyclase, mediating functions in inflammatory responses, nociceptive transmission, and bone homeostasis. Its modulation of cellular signaling underscores its significance in physiological processes, positioning CNR2 Protein as a key regulator in inflammatory, sensory mechanisms, and bone equilibrium. CNR2 Protein, Human (Cell-Free, His) is the recombinant human-derived CNR2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

CNR2 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnr2-protein-human-cf-his.html

Purity

90.00

Smiles

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Molecular Formula

1269 (Gene_ID) P34972 (M1-C360) (Accession)

Molecular Weight

42.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mcee (NM_001106341) Rat Tagged Lenti ORF Clone
RR203483L3 10 µg

Mcee (NM_001106341) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NUDT22 (NM_001128613) Human Tagged Lenti ORF Clone
RC225364L4 10 µg

NUDT22 (NM_001128613) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) SUA5 Polyclonal Antibody
MBS7154065 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) SUA5 Polyclonal Antibody

Sign In for Pricing
View Details
Pnpla5 Mouse shRNA Plasmid (Locus ID 75772)
TL519516 1 Kit

Pnpla5 Mouse shRNA Plasmid (Locus ID 75772)

Sign In for Pricing
View Details
PLCXD1 (NM_018390) Human Over-expression Lysate
LS055344-20ug 20 µg

PLCXD1 (NM_018390) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse Linker for activation of T-cells family member 2 (Lat2), partial
MBS1414133-01 0.5 mg (E-Coli)

Recombinant Mouse Linker for activation of T-cells family member 2 (Lat2), partial

Sign In for Pricing
View Details