Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human recombinant IL-17B (Interleukin-17B) protein, AF

Interleukin 17B (IL-17B) predicts a molecular mass of 20.4 kDa, is expressed in several peripheral tissues and immune tissues. In contrast to the high level of IL-6 secretion stimulated by IL-17A, IL-17B failed to induce IL-6 secretion in fibroblasts; however, it significantly enhanced the TNF-α-induced production of G-CSF and IL-6 in the fibroblasts.

Product Specifications

Synonyms

NIRF, Cytokine ZCYTO7

Gene Name

IL17B

UniProt

Q9UHF5

Reactivity

Human

Tag

His Tag (C-term)

Source

Escherichia coli

Applications

Cell Culture

Purification

>98% as determined by SDS-PAGE.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Bioactivity

Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <49 ng/mL.

Form

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Molecular Weight

The protein has a calculated MW of 19.09 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis) .

Storage Conditions

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

AA Sequence

MQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF with polyhistidine tag at the C-terminus.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pennsylania firefly Luciferase Protein (His Tag)
PDEO100017-01 20 µg

Recombinant Pennsylania firefly Luciferase Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Pennsylania firefly Luciferase Protein (His Tag)
PDEO100017-02 100 µg

Recombinant Pennsylania firefly Luciferase Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Pennsylania firefly Luciferase Protein (His Tag)
PDEO100017-03 500 µg

Recombinant Pennsylania firefly Luciferase Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Pennsylania firefly Luciferase Protein (His Tag)
PDEO100017-04 1 mg

Recombinant Pennsylania firefly Luciferase Protein (His Tag)

Sign In for Pricing
View Details
Gibberellin A6
TRC-G377320-1MG 1 mg

Gibberellin A6

Sign In for Pricing
View Details
PSTVd TaqMan Probe/Primer and Control Set
TM38610 100 Reactions

PSTVd TaqMan Probe/Primer and Control Set

Sign In for Pricing
View Details