Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL17E Mouse

Recombinant mouse IL-17E is a non-glycosylated, disulfide-linked homodimer, containing 2x145 amino acid chains, with a total molecular weight of 35.5 kDa. The Mouse IL-17E is purified by proprietary chromatographic techniques.

Product Specifications

Swiss Prot

Q8VHH8

Source

Escherichia Coli.

Buffer

IL17E was lyophilized from a concentrated (1 mg/mL) solution containing no additives.

Storage Conditions

Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ING1 Antibody Picoband® (Dylight594 Conjugate)
PB9644-Dylight594 100 µg

Anti-ING1 Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
STAT 2, CT (Signal Transducer and Activator of Transcription 2) (MaxLight 550)
MBS6500920-01 0.1 mL

STAT 2, CT (Signal Transducer and Activator of Transcription 2) (MaxLight 550)

Sign In for Pricing
View Details
STAT 2, CT (Signal Transducer and Activator of Transcription 2) (MaxLight 550)
MBS6500920-02 5x 0.1 mL

STAT 2, CT (Signal Transducer and Activator of Transcription 2) (MaxLight 550)

Sign In for Pricing
View Details
Annexin A5/ANXA5, Human (solution)
HY-P7517-01 10 µg

Annexin A5/ANXA5, Human (solution)

Sign In for Pricing
View Details
Annexin A5/ANXA5, Human (solution)
HY-P7517-02 50 µg

Annexin A5/ANXA5, Human (solution)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Eukaryotic Translation Initiation Factor 3A (EIF3A)
MBS2060253-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Eukaryotic Translation Initiation Factor 3A (EIF3A)

Sign In for Pricing
View Details