Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Annexin A5/ANXA5, Human (solution)

Annexin A5 Protein, Human is a 35 kDa multifunctional protein which belongs to the annexin family. Annexin A5 induces in vitro fusion and aggregation of vesicles in a Ca2+- and acidic-pH-dependent manner.Annexin A5 is accepted as an early marker of apoptosis. Annexin A5 has anti-thrombotic and anti-microbial properties[1].

Product Specifications

Product Name Alternative

Annexin A5/ANXA5 Protein, Human (solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/annexin-a5-protein-human.html

Purity

95.10

Smiles

AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Molecular Formula

308 (Gene_ID) P08758 (A2-D320) (Accession)

Molecular Weight

Approximately 33.0 kDa

References & Citations

[1]Guochang Hu, et al. Recombinant human annexin A5: a novel drug candidate for treatment of sepsis? Crit Care Med. 2014 Jan;42 (1) :219-20.|[2]Ghita Ghislat, et al. Annexin A5 stimulates autophagy and inhibits endocytosis. J Cell Sci. 2012 Jan 1;125 (Pt 1) :92-107.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF384 (NM_001039916) Human Over-expression Lysate
LY421852 100 µg

ZNF384 (NM_001039916) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ARRDC4 activation kit by CRISPRa
GA114169 1 Kit

Human ARRDC4 activation kit by CRISPRa

Sign In for Pricing
View Details
N-(2-Aminoethyl)-N'-(5-bromo-6-quinoxalinyl)thiourea
TRC-B677625-500MG 500 mg

N-(2-Aminoethyl)-N'-(5-bromo-6-quinoxalinyl)thiourea

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS805343 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Hydroxy Atrazine
TRC-H828600-10MG 10 mg

Hydroxy Atrazine

Sign In for Pricing
View Details
NADK (NM_001198994) Human Recombinant Protein
TP720242XL 1 mg

NADK (NM_001198994) Human Recombinant Protein

Sign In for Pricing
View Details