Annexin A5/ANXA5, Human (solution)
Annexin A5 Protein, Human is a 35 kDa multifunctional protein which belongs to the annexin family. Annexin A5 induces in vitro fusion and aggregation of vesicles in a Ca2+- and acidic-pH-dependent manner.Annexin A5 is accepted as an early marker of apoptosis. Annexin A5 has anti-thrombotic and anti-microbial properties[1].
Product Specifications
Product Name Alternative
Annexin A5/ANXA5 Protein, Human (solution), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/annexin-a5-protein-human.html
Purity
95.10
Smiles
AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Molecular Formula
308 (Gene_ID) P08758 (A2-D320) (Accession)
Molecular Weight
Approximately 33.0 kDa
References & Citations
[1]Guochang Hu, et al. Recombinant human annexin A5: a novel drug candidate for treatment of sepsis? Crit Care Med. 2014 Jan;42 (1) :219-20.|[2]Ghita Ghislat, et al. Annexin A5 stimulates autophagy and inhibits endocytosis. J Cell Sci. 2012 Jan 1;125 (Pt 1) :92-107.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MS-NRC-30 1 Unit
MS-NRC with 30 x 30 cm platform and flat non-slip rubber mat, 110/220V
Sign In for Pricing
View Details 
