Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse VIP peptides (Vip)

Product Specifications

Abbreviation

Recombinant Mouse Vip protein

Gene Name

Vip

UniProt

P32648

Expression Region

80-155aa

Organism

Mus musculus (Mouse)

Target Sequence

RHADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPVPIKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKR

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

VIP is a neuropeptide involved in a diverse array of physiological processes through activating the PACAP subfamily of class B1 G protein-coupled receptors: VIP receptor 1 (VPR1) and VIP receptor 2 (VPR2) . Abundantly expressed throughout the CNS and peripheral nervous systems where they primarily exert neuroprotective and immune modulatory roles. Also causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Grin3a Mouse shRNA Plasmid (Locus ID 242443)
TR517559 1 Kit

Grin3a Mouse shRNA Plasmid (Locus ID 242443)

Sign In for Pricing
View Details
CD271 Antibody
orb154382 0.1 mg

CD271 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS529343 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Putative UPF0496 protein 2 (Os06g0718300, LOC_Os06g50410)
orb2925152-01 20 µg

Recombinant Oryza sativa subsp. japonica Putative UPF0496 protein 2 (Os06g0718300, LOC_Os06g50410)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Putative UPF0496 protein 2 (Os06g0718300, LOC_Os06g50410)
orb2925152-02 100 µg

Recombinant Oryza sativa subsp. japonica Putative UPF0496 protein 2 (Os06g0718300, LOC_Os06g50410)

Sign In for Pricing
View Details
PKR (EIF2AK2) Mouse Monoclonal Antibody [Clone ID: LBI3F5]
AMM21138V 100 µL

PKR (EIF2AK2) Mouse Monoclonal Antibody [Clone ID: LBI3F5]

Sign In for Pricing
View Details