Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Nitric oxide synthase, endothelial (Nos3), partial

Product Specifications

Product Name Alternative

Constitutive NOS; EC-NOS; NOS type III; Nitric oxide synthase, endothelial

Abbreviation

Recombinant Mouse Nos3 protein, partial

Gene Name

Nos3

UniProt

P70313

Expression Region

516-705aa

Organism

Mus musculus (Mouse)

Target Sequence

RVKATILYGSETGRAQSYAQQLGRLFRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAA

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Produces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. NO mediates vascular endothelial growth factor (VEGF) -induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets. May play a significant role in normal and abnormal limb development

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli O7:K1 Sulfoxide reductase catalytic subunit YedY (yedY)
MBS1053672-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O7:K1 Sulfoxide reductase catalytic subunit YedY (yedY)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Sulfoxide reductase catalytic subunit YedY (yedY)
MBS1053672-02 0.02 mg (Yeast)

Recombinant Escherichia coli O7:K1 Sulfoxide reductase catalytic subunit YedY (yedY)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Sulfoxide reductase catalytic subunit YedY (yedY)
MBS1053672-03 0.1 mg (E-Coli)

Recombinant Escherichia coli O7:K1 Sulfoxide reductase catalytic subunit YedY (yedY)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Sulfoxide reductase catalytic subunit YedY (yedY)
MBS1053672-04 0.1 mg (Yeast)

Recombinant Escherichia coli O7:K1 Sulfoxide reductase catalytic subunit YedY (yedY)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Sulfoxide reductase catalytic subunit YedY (yedY)
MBS1053672-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O7:K1 Sulfoxide reductase catalytic subunit YedY (yedY)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 Sulfoxide reductase catalytic subunit YedY (yedY)
MBS1053672-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli O7:K1 Sulfoxide reductase catalytic subunit YedY (yedY)

Sign In for Pricing
View Details