Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTD Rabbit pAb (APR20517N)

Product Specifications

Background

The protein encoded by this gene functions to recycle protein-bound biotin by cleaving biocytin (biotin-epsilon-lysine), a normal product of carboxylase degradation, resulting in regeneration of free biotin. The encoded protein has also been shown to have biotinyl transferase activity. Mutations in this gene are associated with biotinidase deficiency. Multiple transcript variants encoding different isoforms have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BTD Rabbit pAb (APR20511N5) .

Synonyms

BTD

Gene ID

686

UniProt

P43251

Cellular Locus

Secreted, extracellular space

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 58kDa/61kDa Observed MW: 65-70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=686

Uniprot URL

https://www.uniprot.org/uniprot/P43251

AA Sequence

IQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSNGLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYERD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbonic Anhydrase XIV (CA14) Human shRNA Lentiviral Particle (Locus ID 23632)
TL314259V 500 µL Each

Carbonic Anhydrase XIV (CA14) Human shRNA Lentiviral Particle (Locus ID 23632)

Sign In for Pricing
View Details
RAB11FIP5 (Rab11 Family-interacting Protein 5, Rab11-FIP5, Gamma-SNAP-associated Factor 1, GAF1, Gaf-1, KIAA0857, Phosphoprotein pp75, pp75, Rab11-interacting Protein Rip11, RIP11) (MaxLight 405)
MBS6192111-01 0.1 mL

RAB11FIP5 (Rab11 Family-interacting Protein 5, Rab11-FIP5, Gamma-SNAP-associated Factor 1, GAF1, Gaf-1, KIAA0857, Phosphoprotein pp75, pp75, Rab11-interacting Protein Rip11, RIP11) (MaxLight 405)

Sign In for Pricing
View Details
RAB11FIP5 (Rab11 Family-interacting Protein 5, Rab11-FIP5, Gamma-SNAP-associated Factor 1, GAF1, Gaf-1, KIAA0857, Phosphoprotein pp75, pp75, Rab11-interacting Protein Rip11, RIP11) (MaxLight 405)
MBS6192111-02 5x 0.1 mL

RAB11FIP5 (Rab11 Family-interacting Protein 5, Rab11-FIP5, Gamma-SNAP-associated Factor 1, GAF1, Gaf-1, KIAA0857, Phosphoprotein pp75, pp75, Rab11-interacting Protein Rip11, RIP11) (MaxLight 405)

Sign In for Pricing
View Details
Plant Sjogren Syndrome Antigen B (SSAB) ELISA Kit
MBS9370513 Inquire

Plant Sjogren Syndrome Antigen B (SSAB) ELISA Kit

Sign In for Pricing
View Details
JB-95 (acetate)
HY-P5753A-01 5 mg

JB-95 (acetate)

Sign In for Pricing
View Details
JB-95 (acetate)
HY-P5753A-02 10 mg

JB-95 (acetate)

Sign In for Pricing
View Details