Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI, Mouse (HEK293, His)

TFPI Protein, a potent inhibitor in the coagulation cascade, directly inhibits factor X (Xa) . In a Xa-dependent manner, it also inhibits the activity of VIIa/tissue factor, potentially forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. Beyond its antithrombotic role, TFPI associates with plasma lipoproteins, indicating its regulatory involvement in hemostasis and clotting processes. TFPI Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFPI protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TFPI Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tfpi-protein-mouse-hek293-his.html

Purity

98.0

Smiles

LSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRDYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTGLIKNKSKGVVK

Molecular Formula

21788 (Gene_ID) NP_035706.1 (L29-K289) (Accession)

Molecular Weight

Approximately 45 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Malus domestica Major allergen Mal d 1 (MALD1)
RPC20332-01 20 µg

Recombinant Malus domestica Major allergen Mal d 1 (MALD1)

Sign In for Pricing
View Details
Recombinant Malus domestica Major allergen Mal d 1 (MALD1)
RPC20332-02 100 µg

Recombinant Malus domestica Major allergen Mal d 1 (MALD1)

Sign In for Pricing
View Details
Recombinant Malus domestica Major allergen Mal d 1 (MALD1)
RPC20332-03 1 mg

Recombinant Malus domestica Major allergen Mal d 1 (MALD1)

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21) Antibody Pair Kit (with Standard)
MBS2102871-01 5x 96 Tests

Mouse Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21) Antibody Pair Kit (with Standard)
MBS2102871-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21) Antibody Pair Kit (with Standard)
MBS2102871-03 10x 96 Tests

Mouse Tumor Necrosis Factor Receptor Superfamily, Member 21 (TNFRSF21) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details