Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Malus domestica Major allergen Mal d 1 (MALD1)

Recombinant Malus domestica Major allergen Mal d 1 (MALD1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Malus domestica (Apple) (Pyrus malus) . Target Name: MALD1. Target Synonyms: Allergen Mal d IAllergen: Mal d 1. Accession Number: P43211. Expression Region: 2~159aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Malus domestica Major allergen Mal d 1 (MALD1) is a purified Recombinant Protein.

Accession Number

P43211

Expression Region

2~159aa

Host

E. coli

Target

MALD1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Allergen

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Allergen Mal d IAllergen: Mal d 1

Species

Malus domestica (Apple) (Pyrus malus)

Protein Name

Recombinant Protein

AA Sequence

GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIP30 Rabbit Polyclonal Antibody
E28PN6793 100 µL

NIP30 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
pCR4-TOPO-RSL1D1 Plasmid
PVT28799 2 µg

pCR4-TOPO-RSL1D1 Plasmid

Sign In for Pricing
View Details
Rtl1-set siRNA/shRNA/RNAi Lentivector (Mouse)
42864094 4x 500 ng

Rtl1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Lentiviral human HAUS6 shRNA (UAS) - Lentiviral human HAUS6 shRNA (UAS) (100)
GTR15313125 1 Vial

Lentiviral human HAUS6 shRNA (UAS) - Lentiviral human HAUS6 shRNA (UAS) (100)

Sign In for Pricing
View Details
Lentiviral mouse Map2k6 shRNA (UAS) - Lentiviral mouse Map2k6 shRNA (UAS) plasmid
GTR15281083 1 Vial

Lentiviral mouse Map2k6 shRNA (UAS) - Lentiviral mouse Map2k6 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Caprisil NH2-D HPLC Column, 5 µm, 100 Å, CC553-AD x 150 mm
CC453-AD 5 µm

Caprisil NH2-D HPLC Column, 5 µm, 100 Å, CC553-AD x 150 mm

Sign In for Pricing
View Details