Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Malus domestica Major allergen Mal d 1 (MALD1)

Recombinant Malus domestica Major allergen Mal d 1 (MALD1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Malus domestica (Apple) (Pyrus malus) . Target Name: MALD1. Target Synonyms: Allergen Mal d IAllergen: Mal d 1. Accession Number: P43211. Expression Region: 2~159aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Malus domestica Major allergen Mal d 1 (MALD1) is a purified Recombinant Protein.

Accession Number

P43211

Expression Region

2~159aa

Host

E. coli

Target

MALD1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Allergen

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Allergen Mal d IAllergen: Mal d 1

Species

Malus domestica (Apple) (Pyrus malus)

Protein Name

Recombinant Protein

AA Sequence

GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Homeobox protein aristaless-like 4 (ALX4) ELISA Kit
MBS287332-01 48 Tests

Human Homeobox protein aristaless-like 4 (ALX4) ELISA Kit

Sign In for Pricing
View Details
Human Homeobox protein aristaless-like 4 (ALX4) ELISA Kit
MBS287332-02 96 Tests

Human Homeobox protein aristaless-like 4 (ALX4) ELISA Kit

Sign In for Pricing
View Details
Human Homeobox protein aristaless-like 4 (ALX4) ELISA Kit
MBS287332-03 5x 96 Tests

Human Homeobox protein aristaless-like 4 (ALX4) ELISA Kit

Sign In for Pricing
View Details
Human Homeobox protein aristaless-like 4 (ALX4) ELISA Kit
MBS287332-04 10x 96 Tests

Human Homeobox protein aristaless-like 4 (ALX4) ELISA Kit

Sign In for Pricing
View Details
Aromatic-L-amino-Acid Decarboxylase (DDC) Rat ELISA Kit
B6735 96 Tests

Aromatic-L-amino-Acid Decarboxylase (DDC) Rat ELISA Kit

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 GTPase Era (era)
MBS1175615-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O7:K1 GTPase Era (era)

Sign In for Pricing
View Details