Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Malus domestica Major allergen Mal d 1 (MALD1)

Recombinant Malus domestica Major allergen Mal d 1 (MALD1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Malus domestica (Apple) (Pyrus malus) . Target Name: MALD1. Target Synonyms: Allergen Mal d IAllergen: Mal d 1. Accession Number: P43211. Expression Region: 2~159aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 33.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

CAS Number

9000-83-3

Short Description

Recombinant Malus domestica Major allergen Mal d 1 (MALD1) is a purified Recombinant Protein.

Accession Number

P43211

Expression Region

2~159aa

Host

E. coli

Target

MALD1

Conjugation

Unconjugated

Tag

N-Terminal 6Xhis-Sumo-Tagged

Field of Research

Allergen

Endotoxin

Not Tested

Purity

>90% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

33.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Allergen Mal d IAllergen: Mal d 1

Species

Malus domestica (Apple) (Pyrus malus)

Protein Name

Recombinant Protein

AA Sequence

GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal VWF / Von Willebrand Factor Antibody (clone 21-43), Clone: 21-43
AMM01771G 10.05ml

Monoclonal VWF / Von Willebrand Factor Antibody (clone 21-43), Clone: 21-43

Sign In for Pricing
View Details
Polyclonal Wnt-2 Antibody
APR00346G 0.1ml

Polyclonal Wnt-2 Antibody

Sign In for Pricing
View Details
Spike RBD Monoclonal Antibody
TA398714 100 µg

Spike RBD Monoclonal Antibody

Sign In for Pricing
View Details
BMAL1 Rabbit Polyclonal Antibody
E28PT5423 100 µL

BMAL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRNAE20 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2483907 1.0 µg DNA

TRNAE20 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Plasma Membrane Labeling Lentivirus (LCK)(CFP)
LVP714 2x 100 µL - 10^9 IU/mL

Plasma Membrane Labeling Lentivirus (LCK)(CFP)

Sign In for Pricing
View Details