Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-11 (IL11)

Recombinant Human Interleukin-11 (IL11)

Product Specifications

Product Name Alternative

Adipogenesis inhibitory factor

UniProt

P20809

Expression Region

22-199aa

Tag

N-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCAP31 Rabbit Polyclonal Antibody
orb625053-01 50 µg

BCAP31 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BCAP31 Rabbit Polyclonal Antibody
orb625053-02 100 µg

BCAP31 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KIAA2013 Peptide - C-terminal region
orb2005081 100 µg

KIAA2013 Peptide - C-terminal region

Sign In for Pricing
View Details
Alisol B 23-acetate
T6S2246-01 5 mg

Alisol B 23-acetate

Sign In for Pricing
View Details
Alisol B 23-acetate
T6S2246-02 1 mL - 10 mM (in DMSO)

Alisol B 23-acetate

Sign In for Pricing
View Details
Alisol B 23-acetate
T6S2246-03 10 mg

Alisol B 23-acetate

Sign In for Pricing
View Details