Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA2013 Peptide - C-terminal region

KIAA2013 Peptide - C-terminal region

Product Specifications

UniProt

Q8IYS2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIAA2013 Rabbit Polyclonal Antibody (orb587494) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612355

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQDPGLPFLFWFSVASLITLFHLFLFKLIYNEYCGPGAKPLFRSKEDPSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal HGF Activator Antibody [Allophycocyanin]
NBP2-99223APC 0.1 mL

Rabbit Polyclonal HGF Activator Antibody [Allophycocyanin]

Sign In for Pricing
View Details
TINAGL1 (NM_001204414) Human Tagged ORF Clone
RG234089 10 µg

TINAGL1 (NM_001204414) Human Tagged ORF Clone

Sign In for Pricing
View Details
CCN1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-1290R-BF488-TR 20 µL

CCN1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Chicken Polyclonal Chicken anti-Goat IgG (H+L) Secondary Antibody [DyLight 633] (Pre-absorbed)
NBP1-75548 0.5 mg

Chicken Polyclonal Chicken anti-Goat IgG (H+L) Secondary Antibody [DyLight 633] (Pre-absorbed)

Sign In for Pricing
View Details
Rabbit Polyclonal CAPZA2 Antibody
NBP1-86632 0.1 mL

Rabbit Polyclonal CAPZA2 Antibody

Sign In for Pricing
View Details
Myelin-associated glycoprotein
AP85378 1 mg

Myelin-associated glycoprotein

Sign In for Pricing
View Details